Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J0I4

Protein Details
Accession A0A397J0I4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30DYISHACDNCKNKKRKCNTSGNGYACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MERNDYISHACDNCKNKKRKCNTSGNGYACQRCIDSDIRCRYSPHKPRGRPGKNTNSSPQMDDLSDSSPQANDLSLTNSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.64
4 0.73
5 0.8
6 0.84
7 0.85
8 0.86
9 0.82
10 0.82
11 0.82
12 0.76
13 0.72
14 0.64
15 0.56
16 0.46
17 0.4
18 0.31
19 0.22
20 0.21
21 0.19
22 0.19
23 0.26
24 0.32
25 0.35
26 0.35
27 0.37
28 0.37
29 0.44
30 0.5
31 0.52
32 0.55
33 0.56
34 0.64
35 0.74
36 0.77
37 0.76
38 0.76
39 0.77
40 0.75
41 0.76
42 0.72
43 0.68
44 0.61
45 0.54
46 0.46
47 0.37
48 0.3
49 0.26
50 0.22
51 0.18
52 0.17
53 0.15
54 0.14
55 0.12
56 0.13
57 0.12
58 0.11
59 0.09
60 0.09
61 0.13