Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IQX8

Protein Details
Accession A0A397IQX8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDNKEKKKKCRKGRTHRYRKREKLHILNFKKRGKBasic
38-58DNNWKSFRKWLKRQGLPKTKFHydrophilic
NLS Segment(s)
PositionSequence
4-35KEKKKKCRKGRTHRYRKREKLHILNFKKRGKV
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDNKEKKKKCRKGRTHRYRKREKLHILNFKKRGKVIQDNNWKSFRKWLKRQGLPKTKFTLAEFGDTGRGLMATKDIKESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.95
5 0.95
6 0.94
7 0.92
8 0.91
9 0.89
10 0.88
11 0.88
12 0.88
13 0.86
14 0.85
15 0.84
16 0.78
17 0.72
18 0.62
19 0.56
20 0.53
21 0.54
22 0.52
23 0.53
24 0.6
25 0.61
26 0.64
27 0.65
28 0.58
29 0.49
30 0.5
31 0.5
32 0.49
33 0.53
34 0.59
35 0.64
36 0.71
37 0.79
38 0.81
39 0.83
40 0.77
41 0.74
42 0.69
43 0.62
44 0.57
45 0.49
46 0.45
47 0.36
48 0.35
49 0.3
50 0.25
51 0.24
52 0.21
53 0.2
54 0.12
55 0.11
56 0.08
57 0.08
58 0.12
59 0.14
60 0.15