Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397INZ6

Protein Details
Accession A0A397INZ6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-125YDKVKSATGKRSRKRFNPPKEEETQQHydrophilic
NLS Segment(s)
PositionSequence
109-114KRSRKR
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MPFGIEKVLYRGAKRYQMTSKKGHNYYKGTGSGAMGRHTSRGGYIIDLRKVRTYVVPDLSNCEYKPYVAPEAKRGIKYSLNAKEYVNILRKELYPTETIYDKVKSATGKRSRKRFNPPKEEETQQQEEVTAEKQSKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.49
4 0.56
5 0.6
6 0.62
7 0.66
8 0.67
9 0.73
10 0.73
11 0.7
12 0.67
13 0.66
14 0.64
15 0.56
16 0.48
17 0.41
18 0.35
19 0.31
20 0.26
21 0.23
22 0.19
23 0.17
24 0.17
25 0.16
26 0.15
27 0.12
28 0.12
29 0.11
30 0.11
31 0.17
32 0.2
33 0.25
34 0.26
35 0.27
36 0.26
37 0.26
38 0.25
39 0.22
40 0.22
41 0.22
42 0.24
43 0.25
44 0.23
45 0.28
46 0.29
47 0.28
48 0.23
49 0.21
50 0.17
51 0.16
52 0.17
53 0.15
54 0.18
55 0.19
56 0.2
57 0.21
58 0.28
59 0.3
60 0.3
61 0.29
62 0.26
63 0.26
64 0.28
65 0.32
66 0.33
67 0.32
68 0.32
69 0.31
70 0.3
71 0.29
72 0.33
73 0.3
74 0.24
75 0.23
76 0.24
77 0.24
78 0.26
79 0.25
80 0.23
81 0.18
82 0.18
83 0.2
84 0.19
85 0.2
86 0.19
87 0.19
88 0.17
89 0.16
90 0.17
91 0.19
92 0.23
93 0.32
94 0.39
95 0.48
96 0.56
97 0.66
98 0.73
99 0.78
100 0.85
101 0.85
102 0.86
103 0.87
104 0.86
105 0.84
106 0.8
107 0.77
108 0.72
109 0.7
110 0.64
111 0.55
112 0.47
113 0.4
114 0.34
115 0.31
116 0.25
117 0.22
118 0.18