Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GNJ1

Protein Details
Accession A0A397GNJ1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-54LPPTLPSPRLRRRQRRGPYNRTRSTTHydrophilic
NLS Segment(s)
PositionSequence
39-44RRRQRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MADHNSQQLLLPPNFQSPSQPQQPRRLVLPPTLPSPRLRRRQRRGPYNRTRSTTTANTTVICTICLSPPNRDKSTMLLQEEDSLHIFNNGDDDDDDYVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.29
5 0.35
6 0.42
7 0.49
8 0.49
9 0.58
10 0.64
11 0.61
12 0.58
13 0.56
14 0.49
15 0.46
16 0.47
17 0.4
18 0.39
19 0.4
20 0.38
21 0.36
22 0.43
23 0.47
24 0.5
25 0.58
26 0.64
27 0.7
28 0.79
29 0.85
30 0.87
31 0.88
32 0.88
33 0.89
34 0.88
35 0.85
36 0.78
37 0.72
38 0.63
39 0.59
40 0.52
41 0.44
42 0.37
43 0.32
44 0.29
45 0.25
46 0.24
47 0.19
48 0.15
49 0.13
50 0.1
51 0.1
52 0.15
53 0.16
54 0.21
55 0.28
56 0.35
57 0.36
58 0.38
59 0.38
60 0.39
61 0.46
62 0.45
63 0.4
64 0.35
65 0.33
66 0.34
67 0.34
68 0.3
69 0.22
70 0.16
71 0.14
72 0.14
73 0.13
74 0.1
75 0.12
76 0.1
77 0.11
78 0.11
79 0.13