Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397FZ77

Protein Details
Accession A0A397FZ77    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ERYFEKFRTRFWKRPQKCHNRIPPPTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MCQYMAGNKSGRQSKVGERYFEKFRTRFWKRPQKCHNRIPPPTYEEVSSMLSYRESPASQKDRSASPTCRILSRRGEVSNNASNIVNETREAKVYYFVIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.53
4 0.5
5 0.48
6 0.51
7 0.55
8 0.56
9 0.55
10 0.45
11 0.47
12 0.53
13 0.57
14 0.61
15 0.65
16 0.71
17 0.71
18 0.81
19 0.85
20 0.86
21 0.86
22 0.87
23 0.87
24 0.86
25 0.85
26 0.78
27 0.72
28 0.65
29 0.6
30 0.51
31 0.41
32 0.31
33 0.27
34 0.24
35 0.19
36 0.14
37 0.11
38 0.1
39 0.1
40 0.1
41 0.09
42 0.08
43 0.09
44 0.16
45 0.21
46 0.22
47 0.24
48 0.25
49 0.26
50 0.32
51 0.36
52 0.33
53 0.31
54 0.38
55 0.36
56 0.4
57 0.4
58 0.4
59 0.41
60 0.41
61 0.43
62 0.39
63 0.41
64 0.39
65 0.44
66 0.44
67 0.38
68 0.35
69 0.3
70 0.27
71 0.27
72 0.26
73 0.2
74 0.15
75 0.17
76 0.17
77 0.19
78 0.2
79 0.18
80 0.19
81 0.19