Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397I5A8

Protein Details
Accession A0A397I5A8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-64TITPAAPTKKRGRPKKIQKVEDKTTEDHydrophilic
NLS Segment(s)
PositionSequence
45-54TKKRGRPKKI
Subcellular Location(s) nucl 19, mito_nucl 13.499, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MNYNMDNSTSTIASTSPNRKRGRLRMEKAVHTTQTTSTITPAAPTKKRGRPKKIQKVEDKTTEDLHKIKNIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.28
3 0.33
4 0.42
5 0.45
6 0.51
7 0.59
8 0.66
9 0.7
10 0.71
11 0.68
12 0.7
13 0.72
14 0.71
15 0.68
16 0.62
17 0.52
18 0.42
19 0.37
20 0.28
21 0.26
22 0.22
23 0.17
24 0.14
25 0.13
26 0.12
27 0.12
28 0.16
29 0.18
30 0.2
31 0.26
32 0.34
33 0.42
34 0.52
35 0.61
36 0.67
37 0.71
38 0.8
39 0.86
40 0.88
41 0.89
42 0.9
43 0.88
44 0.87
45 0.85
46 0.78
47 0.7
48 0.64
49 0.59
50 0.52
51 0.47
52 0.43