Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H3E9

Protein Details
Accession A0A397H3E9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
92-116GVPIFIYYRNKKKRRGDKAHIVETAHydrophilic
NLS Segment(s)
PositionSequence
102-107KKKRRG
Subcellular Location(s) plas 13, mito 6, extr 4, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKFTAKTFSFFAIFCLIIIAVVAQAPSDTPTLTSSPSTTDYVDTGIPTSPTATAESTSPSPSPSSSSSGLPKLVKTFLIGFGAVNGAMILIGVPIFIYYRNKKKRRGDKAHIVETAGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.12
4 0.1
5 0.1
6 0.07
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.04
13 0.06
14 0.06
15 0.06
16 0.07
17 0.09
18 0.1
19 0.12
20 0.12
21 0.11
22 0.13
23 0.16
24 0.17
25 0.15
26 0.15
27 0.14
28 0.14
29 0.14
30 0.12
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.09
39 0.08
40 0.08
41 0.08
42 0.1
43 0.11
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.13
50 0.13
51 0.16
52 0.16
53 0.18
54 0.2
55 0.21
56 0.24
57 0.21
58 0.2
59 0.18
60 0.18
61 0.16
62 0.15
63 0.15
64 0.13
65 0.14
66 0.13
67 0.11
68 0.1
69 0.1
70 0.08
71 0.07
72 0.05
73 0.03
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.06
84 0.13
85 0.21
86 0.32
87 0.43
88 0.5
89 0.6
90 0.71
91 0.8
92 0.84
93 0.87
94 0.87
95 0.87
96 0.9
97 0.88
98 0.79
99 0.7