Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GV12

Protein Details
Accession A0A397GV12    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-107VTITKYKDIRTEKKNKKKRTSKNLEGININHydrophilic
NLS Segment(s)
PositionSequence
87-97RTEKKNKKKRT
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MWDLVNKLLKAFDARDYNEFNNNNDLFHVTNPKEMYAEGIKQLKELYGQGLHRIRLIYRQEVLKKETIITVGRRAKDVTITKYKDIRTEKKNKKKRTSKNLEGININEQILPADPVIHQKFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.37
4 0.38
5 0.42
6 0.42
7 0.37
8 0.38
9 0.36
10 0.32
11 0.27
12 0.27
13 0.2
14 0.21
15 0.26
16 0.19
17 0.24
18 0.24
19 0.23
20 0.22
21 0.21
22 0.23
23 0.18
24 0.18
25 0.18
26 0.22
27 0.21
28 0.21
29 0.21
30 0.18
31 0.16
32 0.15
33 0.13
34 0.13
35 0.13
36 0.19
37 0.22
38 0.21
39 0.21
40 0.21
41 0.19
42 0.22
43 0.25
44 0.21
45 0.2
46 0.25
47 0.27
48 0.29
49 0.31
50 0.26
51 0.24
52 0.22
53 0.2
54 0.18
55 0.17
56 0.16
57 0.22
58 0.25
59 0.25
60 0.26
61 0.26
62 0.24
63 0.29
64 0.32
65 0.3
66 0.34
67 0.37
68 0.4
69 0.44
70 0.45
71 0.46
72 0.5
73 0.51
74 0.52
75 0.6
76 0.68
77 0.74
78 0.83
79 0.85
80 0.88
81 0.91
82 0.92
83 0.92
84 0.92
85 0.91
86 0.9
87 0.88
88 0.82
89 0.74
90 0.66
91 0.6
92 0.51
93 0.41
94 0.32
95 0.24
96 0.19
97 0.17
98 0.15
99 0.1
100 0.1
101 0.1
102 0.19