Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HF77

Protein Details
Accession A0A397HF77    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKSGRDRIKCIKCKLCKNDKNNRHFDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, nucl 12, mito 11, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MKSGRDRIKCIKCKLCKNDKNNRHFDYNGVICHLKSSCHKVVKVMVEEMISVNRERVVDCVPMIFPFDGSASESFQHFRHWHATWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.85
4 0.86
5 0.87
6 0.87
7 0.87
8 0.86
9 0.8
10 0.74
11 0.65
12 0.57
13 0.53
14 0.46
15 0.37
16 0.31
17 0.27
18 0.22
19 0.23
20 0.21
21 0.16
22 0.16
23 0.23
24 0.26
25 0.3
26 0.3
27 0.3
28 0.34
29 0.36
30 0.34
31 0.27
32 0.21
33 0.17
34 0.17
35 0.16
36 0.12
37 0.09
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.1
44 0.11
45 0.12
46 0.12
47 0.13
48 0.12
49 0.12
50 0.14
51 0.12
52 0.1
53 0.09
54 0.1
55 0.09
56 0.11
57 0.12
58 0.11
59 0.12
60 0.13
61 0.14
62 0.14
63 0.21
64 0.2
65 0.23
66 0.28