Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XPH9

Protein Details
Accession K1XPH9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
233-257RSTESRSPYRKRRDLSNDRQHARNRHydrophilic
NLS Segment(s)
PositionSequence
177-193ASPPRNRHADPERKRRR
207-246RKPLRERASSRSTRRRFQQSDPPARGRSTESRSPYRKRRD
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
KEGG mbe:MBM_07150  -  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MNRYARGPLAASSKATASTLCQKCLKRDESIASISECAKTNIGLRHYSYECKAVIQERPYVSRPSRTQQLLNPKLQPRLMTSDAPLDLMRKKGIADELLAKADQERGRKRERQSEEAEAPGTSKRMRSASSASVSSISTGISRSPSPHQATRDYSTSKSTQRNVAPPSRRRSPTMSASPPRNRHADPERKRRRDSFSSTDSYSSAERKPLRERASSRSTRRRFQQSDPPARGRSTESRSPYRKRRDLSNDRQHARNRLSGIENRPPPPKERSLSPFSKRLALTQAMNGGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.18
5 0.26
6 0.28
7 0.32
8 0.38
9 0.4
10 0.48
11 0.56
12 0.55
13 0.5
14 0.53
15 0.54
16 0.52
17 0.51
18 0.46
19 0.38
20 0.36
21 0.31
22 0.28
23 0.23
24 0.2
25 0.17
26 0.16
27 0.2
28 0.24
29 0.27
30 0.27
31 0.29
32 0.33
33 0.35
34 0.38
35 0.35
36 0.33
37 0.3
38 0.28
39 0.29
40 0.26
41 0.3
42 0.29
43 0.33
44 0.32
45 0.36
46 0.38
47 0.42
48 0.4
49 0.43
50 0.44
51 0.44
52 0.5
53 0.49
54 0.5
55 0.49
56 0.58
57 0.57
58 0.57
59 0.58
60 0.54
61 0.55
62 0.53
63 0.47
64 0.4
65 0.4
66 0.38
67 0.32
68 0.29
69 0.29
70 0.27
71 0.27
72 0.23
73 0.19
74 0.17
75 0.18
76 0.17
77 0.13
78 0.13
79 0.13
80 0.15
81 0.14
82 0.14
83 0.16
84 0.17
85 0.18
86 0.17
87 0.15
88 0.14
89 0.18
90 0.19
91 0.23
92 0.28
93 0.33
94 0.4
95 0.47
96 0.52
97 0.56
98 0.6
99 0.59
100 0.58
101 0.59
102 0.54
103 0.48
104 0.44
105 0.34
106 0.28
107 0.22
108 0.18
109 0.12
110 0.11
111 0.12
112 0.13
113 0.15
114 0.17
115 0.2
116 0.23
117 0.25
118 0.25
119 0.22
120 0.22
121 0.2
122 0.17
123 0.13
124 0.09
125 0.07
126 0.06
127 0.07
128 0.07
129 0.08
130 0.09
131 0.12
132 0.18
133 0.21
134 0.25
135 0.27
136 0.3
137 0.34
138 0.35
139 0.36
140 0.32
141 0.29
142 0.29
143 0.3
144 0.31
145 0.32
146 0.32
147 0.34
148 0.35
149 0.41
150 0.42
151 0.47
152 0.5
153 0.52
154 0.56
155 0.58
156 0.57
157 0.54
158 0.55
159 0.53
160 0.52
161 0.53
162 0.55
163 0.52
164 0.59
165 0.63
166 0.63
167 0.6
168 0.57
169 0.49
170 0.48
171 0.53
172 0.55
173 0.57
174 0.63
175 0.71
176 0.74
177 0.78
178 0.77
179 0.75
180 0.72
181 0.71
182 0.67
183 0.62
184 0.59
185 0.56
186 0.51
187 0.43
188 0.36
189 0.29
190 0.25
191 0.2
192 0.23
193 0.24
194 0.28
195 0.35
196 0.42
197 0.45
198 0.5
199 0.53
200 0.53
201 0.6
202 0.65
203 0.67
204 0.7
205 0.71
206 0.69
207 0.74
208 0.76
209 0.72
210 0.7
211 0.71
212 0.71
213 0.76
214 0.76
215 0.74
216 0.66
217 0.61
218 0.56
219 0.51
220 0.49
221 0.45
222 0.46
223 0.47
224 0.54
225 0.61
226 0.69
227 0.73
228 0.75
229 0.76
230 0.72
231 0.76
232 0.77
233 0.8
234 0.82
235 0.83
236 0.82
237 0.78
238 0.82
239 0.77
240 0.75
241 0.69
242 0.63
243 0.54
244 0.49
245 0.51
246 0.51
247 0.53
248 0.54
249 0.56
250 0.54
251 0.59
252 0.57
253 0.56
254 0.56
255 0.57
256 0.52
257 0.54
258 0.57
259 0.58
260 0.65
261 0.67
262 0.66
263 0.6
264 0.63
265 0.54
266 0.51
267 0.49
268 0.44
269 0.4
270 0.37
271 0.38