Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JC34

Protein Details
Accession A0A397JC34    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-58KNGENFRKRTKAKRKEKIPVTFSHydrophilic
NLS Segment(s)
PositionSequence
41-52FRKRTKAKRKEK
Subcellular Location(s) nucl 12, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MAIHLRTMETYLSIHFYGIPKSLRISDFGLSKEIGKNGENFRKRTKAKRKEKIPVTFSSGDELVEETINFDGDDNDDNNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.15
5 0.19
6 0.19
7 0.16
8 0.18
9 0.21
10 0.19
11 0.21
12 0.22
13 0.2
14 0.21
15 0.21
16 0.21
17 0.18
18 0.19
19 0.18
20 0.16
21 0.15
22 0.13
23 0.16
24 0.21
25 0.29
26 0.32
27 0.33
28 0.37
29 0.44
30 0.48
31 0.55
32 0.6
33 0.62
34 0.69
35 0.76
36 0.81
37 0.82
38 0.87
39 0.86
40 0.79
41 0.72
42 0.68
43 0.61
44 0.52
45 0.45
46 0.36
47 0.27
48 0.22
49 0.19
50 0.13
51 0.1
52 0.1
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.11
61 0.11