Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HB02

Protein Details
Accession A0A397HB02    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-41KVKNYIVKVIKEKKEKKEKKKSLKKERKLKAKEVMEBasic
NLS Segment(s)
PositionSequence
15-37IKEKKEKKEKKKSLKKERKLKAK
Subcellular Location(s) mito 10.5, mito_nucl 10.499, cyto_nucl 9.833, nucl 9, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MNLTTKVKNYIVKVIKEKKEKKEKKKSLKKERKLKAKEVMEEVFELEKEKKLVEEERDGAAGFDYPRIFFLTKVVDGEVLFGDIVFGEPKDQEGMYVEFKGEGWNEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.71
4 0.76
5 0.76
6 0.81
7 0.85
8 0.86
9 0.88
10 0.9
11 0.91
12 0.94
13 0.95
14 0.95
15 0.96
16 0.95
17 0.94
18 0.92
19 0.92
20 0.88
21 0.84
22 0.82
23 0.77
24 0.71
25 0.65
26 0.57
27 0.46
28 0.4
29 0.33
30 0.23
31 0.17
32 0.15
33 0.1
34 0.1
35 0.1
36 0.09
37 0.09
38 0.11
39 0.14
40 0.15
41 0.18
42 0.18
43 0.18
44 0.19
45 0.18
46 0.16
47 0.13
48 0.11
49 0.08
50 0.08
51 0.08
52 0.07
53 0.08
54 0.11
55 0.11
56 0.1
57 0.13
58 0.14
59 0.15
60 0.15
61 0.15
62 0.13
63 0.13
64 0.14
65 0.11
66 0.08
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.09
78 0.09
79 0.09
80 0.12
81 0.15
82 0.17
83 0.17
84 0.17
85 0.15
86 0.16
87 0.18