Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IPW7

Protein Details
Accession A0A397IPW7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKQRRKKIKSEEKSPYFKKESBasic
NLS Segment(s)
PositionSequence
4-9RRKKIK
Subcellular Location(s) nucl 17, mito_nucl 12.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR045138  MeCP2/MBD4  
Gene Ontology GO:0005634  C:nucleus  
GO:0003824  F:catalytic activity  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
Amino Acid Sequences MKQRRKKIKSEEKSPYFKKESKSNVASPYFQNVVKFEDTVSKYFVSSKKKSSIKSEGKIPLKEEEWKEKIPLKEEGWEEKFPLKEDEWEEKKLFTENLVLITKNRKTTSYDIETLASMEPIVYVPKFVPMSSPYNLVQETLYYDPWKLLVATTFLNRTKGTQAFPIMWKFLEEYSTPQKTIKAGTTKIANLLRPLGLQNIRAERLVKFSLTYLANPDFSTPKELFGMGQYAEDSWRLFCGEEDDAWMEGSGLEPTDKMLKMYINWRRVVHKGYLKDNEMSIDDAQRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.79
4 0.74
5 0.7
6 0.69
7 0.69
8 0.68
9 0.7
10 0.67
11 0.67
12 0.66
13 0.63
14 0.56
15 0.52
16 0.46
17 0.4
18 0.36
19 0.29
20 0.3
21 0.28
22 0.26
23 0.21
24 0.26
25 0.28
26 0.27
27 0.28
28 0.24
29 0.23
30 0.29
31 0.34
32 0.34
33 0.37
34 0.42
35 0.48
36 0.54
37 0.57
38 0.6
39 0.65
40 0.66
41 0.65
42 0.68
43 0.68
44 0.69
45 0.67
46 0.6
47 0.54
48 0.47
49 0.49
50 0.45
51 0.45
52 0.43
53 0.42
54 0.44
55 0.45
56 0.45
57 0.42
58 0.43
59 0.35
60 0.36
61 0.38
62 0.42
63 0.41
64 0.39
65 0.37
66 0.35
67 0.34
68 0.3
69 0.3
70 0.23
71 0.23
72 0.27
73 0.35
74 0.35
75 0.38
76 0.37
77 0.34
78 0.34
79 0.31
80 0.26
81 0.18
82 0.17
83 0.13
84 0.17
85 0.18
86 0.17
87 0.17
88 0.23
89 0.25
90 0.27
91 0.27
92 0.24
93 0.28
94 0.32
95 0.38
96 0.37
97 0.37
98 0.33
99 0.33
100 0.31
101 0.27
102 0.23
103 0.15
104 0.09
105 0.06
106 0.05
107 0.05
108 0.06
109 0.04
110 0.05
111 0.05
112 0.09
113 0.09
114 0.09
115 0.11
116 0.13
117 0.17
118 0.18
119 0.21
120 0.18
121 0.19
122 0.19
123 0.18
124 0.14
125 0.1
126 0.12
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.06
135 0.05
136 0.06
137 0.07
138 0.08
139 0.09
140 0.12
141 0.13
142 0.14
143 0.14
144 0.15
145 0.18
146 0.19
147 0.19
148 0.19
149 0.2
150 0.2
151 0.22
152 0.22
153 0.19
154 0.17
155 0.16
156 0.14
157 0.13
158 0.12
159 0.1
160 0.14
161 0.2
162 0.22
163 0.22
164 0.22
165 0.23
166 0.22
167 0.24
168 0.25
169 0.23
170 0.23
171 0.25
172 0.28
173 0.27
174 0.32
175 0.32
176 0.27
177 0.23
178 0.23
179 0.2
180 0.18
181 0.18
182 0.18
183 0.17
184 0.18
185 0.21
186 0.23
187 0.23
188 0.24
189 0.24
190 0.2
191 0.23
192 0.22
193 0.19
194 0.16
195 0.15
196 0.19
197 0.19
198 0.19
199 0.18
200 0.19
201 0.2
202 0.19
203 0.2
204 0.17
205 0.17
206 0.22
207 0.18
208 0.18
209 0.18
210 0.18
211 0.16
212 0.16
213 0.18
214 0.12
215 0.12
216 0.11
217 0.1
218 0.11
219 0.12
220 0.11
221 0.08
222 0.09
223 0.09
224 0.09
225 0.09
226 0.13
227 0.13
228 0.13
229 0.16
230 0.17
231 0.16
232 0.16
233 0.16
234 0.12
235 0.1
236 0.1
237 0.07
238 0.06
239 0.06
240 0.06
241 0.08
242 0.13
243 0.13
244 0.13
245 0.15
246 0.16
247 0.19
248 0.3
249 0.37
250 0.39
251 0.43
252 0.45
253 0.48
254 0.52
255 0.53
256 0.52
257 0.52
258 0.52
259 0.56
260 0.61
261 0.6
262 0.57
263 0.53
264 0.47
265 0.4
266 0.36
267 0.29
268 0.29