Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J8M0

Protein Details
Accession A0A397J8M0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
84-103HQPKAPPPDVRGKKKKKPISBasic
NLS Segment(s)
PositionSequence
90-103PPDVRGKKKKKPIS
Subcellular Location(s) nucl 23, cyto_nucl 13.333, cyto_mito 2.166
Family & Domain DBs
Amino Acid Sequences MGSNPMSPGGNGMGFGPLSLLGGGVKSNNTGPKSNNNNNNPQQSGSKSPMPTAPSNSISKSLSPAGGTPGGIVLHHLQEVLILHQPKAPPPDVRGKKKKKPIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.06
5 0.07
6 0.06
7 0.06
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.09
15 0.14
16 0.17
17 0.19
18 0.22
19 0.31
20 0.4
21 0.46
22 0.53
23 0.53
24 0.6
25 0.63
26 0.65
27 0.57
28 0.49
29 0.44
30 0.37
31 0.37
32 0.32
33 0.31
34 0.26
35 0.26
36 0.27
37 0.28
38 0.27
39 0.26
40 0.26
41 0.24
42 0.26
43 0.25
44 0.25
45 0.22
46 0.21
47 0.2
48 0.17
49 0.14
50 0.13
51 0.13
52 0.13
53 0.13
54 0.12
55 0.1
56 0.1
57 0.09
58 0.08
59 0.1
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.08
66 0.09
67 0.09
68 0.13
69 0.14
70 0.14
71 0.17
72 0.18
73 0.21
74 0.26
75 0.28
76 0.26
77 0.3
78 0.41
79 0.49
80 0.59
81 0.66
82 0.71
83 0.78