Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IXQ3

Protein Details
Accession A0A397IXQ3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-31LEAKRELKRLREKKAERELIRBasic
NLS Segment(s)
PositionSequence
14-28KRELKRLREKKAERE
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
Pfam View protein in Pfam  
PF00612  IQ  
Amino Acid Sequences MQSLQNLIKSLEAKRELKRLREKKAERELIRIREEKAAVIIQKYWRRYIKPLNNNNNDNNNKKCNLSSLRFPVKNPNREKTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.48
3 0.49
4 0.56
5 0.65
6 0.65
7 0.68
8 0.74
9 0.76
10 0.76
11 0.81
12 0.82
13 0.72
14 0.73
15 0.71
16 0.66
17 0.65
18 0.57
19 0.48
20 0.42
21 0.41
22 0.32
23 0.26
24 0.22
25 0.17
26 0.15
27 0.16
28 0.18
29 0.22
30 0.23
31 0.27
32 0.29
33 0.31
34 0.36
35 0.45
36 0.49
37 0.55
38 0.64
39 0.68
40 0.73
41 0.75
42 0.74
43 0.73
44 0.69
45 0.65
46 0.6
47 0.55
48 0.49
49 0.46
50 0.42
51 0.4
52 0.41
53 0.4
54 0.43
55 0.48
56 0.56
57 0.56
58 0.57
59 0.61
60 0.63
61 0.68
62 0.67
63 0.67