Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IR86

Protein Details
Accession A0A397IR86    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-136FIDPIKKKKKRVETEPNNMGDHydrophilic
NLS Segment(s)
PositionSequence
121-125KKKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.333, cyto 6, cyto_mito 5.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MVSSRGDQRITKSYTDAVYDLSKAIVIDSKNCLALKCRAYCYYMLREYEEALCDLKVVIILGCADESTYINKINIMNELKNLNNSTQRDLVDMGAPSSVNDSSYVNKIKNSSDNNFIDPIKKKKKRVETEPNNMGDSMIEENNNYSQPDNEIIPIIDLYNNNNNDDDVDENNNGTNNKLYSYAIKEFIDICRQYPSIVNYIIFIKGVSDQGVSLRNDSESIICIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.31
4 0.25
5 0.23
6 0.22
7 0.19
8 0.16
9 0.14
10 0.12
11 0.12
12 0.13
13 0.12
14 0.14
15 0.18
16 0.2
17 0.23
18 0.23
19 0.23
20 0.23
21 0.3
22 0.34
23 0.35
24 0.38
25 0.36
26 0.38
27 0.41
28 0.43
29 0.43
30 0.41
31 0.38
32 0.36
33 0.35
34 0.34
35 0.32
36 0.28
37 0.21
38 0.16
39 0.14
40 0.11
41 0.1
42 0.09
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.05
53 0.06
54 0.07
55 0.09
56 0.1
57 0.1
58 0.12
59 0.13
60 0.13
61 0.18
62 0.19
63 0.19
64 0.2
65 0.22
66 0.2
67 0.22
68 0.23
69 0.19
70 0.22
71 0.23
72 0.25
73 0.26
74 0.25
75 0.24
76 0.23
77 0.22
78 0.17
79 0.16
80 0.12
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.06
87 0.07
88 0.07
89 0.08
90 0.13
91 0.15
92 0.14
93 0.16
94 0.17
95 0.18
96 0.23
97 0.26
98 0.25
99 0.3
100 0.3
101 0.31
102 0.31
103 0.3
104 0.28
105 0.28
106 0.35
107 0.39
108 0.44
109 0.5
110 0.56
111 0.67
112 0.7
113 0.76
114 0.78
115 0.77
116 0.8
117 0.8
118 0.74
119 0.64
120 0.55
121 0.45
122 0.33
123 0.24
124 0.17
125 0.11
126 0.09
127 0.08
128 0.09
129 0.1
130 0.11
131 0.1
132 0.08
133 0.08
134 0.1
135 0.12
136 0.11
137 0.1
138 0.1
139 0.1
140 0.1
141 0.1
142 0.08
143 0.08
144 0.08
145 0.11
146 0.18
147 0.19
148 0.19
149 0.19
150 0.19
151 0.18
152 0.19
153 0.17
154 0.13
155 0.15
156 0.14
157 0.14
158 0.15
159 0.17
160 0.16
161 0.15
162 0.15
163 0.12
164 0.13
165 0.14
166 0.15
167 0.16
168 0.22
169 0.25
170 0.26
171 0.25
172 0.25
173 0.25
174 0.27
175 0.31
176 0.26
177 0.24
178 0.25
179 0.25
180 0.25
181 0.28
182 0.29
183 0.25
184 0.27
185 0.26
186 0.22
187 0.23
188 0.23
189 0.19
190 0.15
191 0.11
192 0.11
193 0.12
194 0.12
195 0.1
196 0.1
197 0.13
198 0.19
199 0.19
200 0.19
201 0.19
202 0.18
203 0.19
204 0.19
205 0.18