Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IRF3

Protein Details
Accession A0A397IRF3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
59-83PAPYIPYRSPRPKHQHQQPLPPPAAHydrophilic
NLS Segment(s)
PositionSequence
155-167PPRKKIVVDGKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, cyto 4, cyto_mito 3.333, plas 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSFQEFANIDENIEEIINELKKKFPKGPNFVKRGVQTIADGFTVPFDEWASYLVKAPPPAPYIPYRSPRPKHQHQQPLPPPAAPAPTPIPAPVPPNPNNPNSLPPNFRSTGNKNVDNYLVFLESCKNQSYKPTNGDISNSGETSREEPKNEVMRPPRKKIVVDGKKKPVASKNLNESKQRTLDEANKILQSLFATRQNNQMTFSIPPISEVLIKKRTKGKEVAKLATTLKSIDLNEGSSGSGGTSSTSSSQPFIVKLKIPPRIHPIVEVDKKEGSSGDNNNNNNNNNNXMIIKIFIMTKIMIIVIIIVIVIAVIIGIEFPNFPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.12
4 0.15
5 0.17
6 0.18
7 0.23
8 0.29
9 0.35
10 0.44
11 0.48
12 0.56
13 0.64
14 0.74
15 0.78
16 0.79
17 0.78
18 0.76
19 0.68
20 0.63
21 0.55
22 0.45
23 0.37
24 0.32
25 0.29
26 0.23
27 0.21
28 0.15
29 0.14
30 0.14
31 0.11
32 0.1
33 0.09
34 0.08
35 0.08
36 0.1
37 0.11
38 0.1
39 0.13
40 0.15
41 0.17
42 0.18
43 0.19
44 0.22
45 0.24
46 0.25
47 0.26
48 0.27
49 0.33
50 0.39
51 0.45
52 0.49
53 0.56
54 0.6
55 0.67
56 0.72
57 0.75
58 0.78
59 0.81
60 0.84
61 0.8
62 0.86
63 0.84
64 0.83
65 0.73
66 0.63
67 0.54
68 0.45
69 0.41
70 0.3
71 0.26
72 0.2
73 0.2
74 0.2
75 0.19
76 0.2
77 0.18
78 0.23
79 0.24
80 0.28
81 0.3
82 0.38
83 0.42
84 0.41
85 0.43
86 0.41
87 0.42
88 0.41
89 0.42
90 0.37
91 0.35
92 0.39
93 0.37
94 0.37
95 0.38
96 0.37
97 0.43
98 0.45
99 0.47
100 0.42
101 0.42
102 0.42
103 0.35
104 0.31
105 0.22
106 0.16
107 0.12
108 0.11
109 0.11
110 0.11
111 0.12
112 0.13
113 0.13
114 0.13
115 0.21
116 0.27
117 0.31
118 0.33
119 0.35
120 0.36
121 0.36
122 0.37
123 0.31
124 0.3
125 0.25
126 0.21
127 0.17
128 0.15
129 0.15
130 0.16
131 0.21
132 0.18
133 0.18
134 0.19
135 0.25
136 0.31
137 0.31
138 0.34
139 0.37
140 0.45
141 0.5
142 0.53
143 0.53
144 0.49
145 0.49
146 0.5
147 0.52
148 0.52
149 0.55
150 0.57
151 0.6
152 0.61
153 0.61
154 0.57
155 0.52
156 0.51
157 0.49
158 0.47
159 0.49
160 0.54
161 0.58
162 0.58
163 0.55
164 0.51
165 0.47
166 0.43
167 0.35
168 0.3
169 0.33
170 0.34
171 0.34
172 0.31
173 0.27
174 0.26
175 0.24
176 0.21
177 0.15
178 0.13
179 0.13
180 0.17
181 0.19
182 0.2
183 0.27
184 0.3
185 0.3
186 0.29
187 0.27
188 0.23
189 0.22
190 0.22
191 0.17
192 0.14
193 0.15
194 0.13
195 0.13
196 0.16
197 0.16
198 0.21
199 0.27
200 0.28
201 0.31
202 0.39
203 0.41
204 0.42
205 0.5
206 0.52
207 0.53
208 0.6
209 0.6
210 0.53
211 0.53
212 0.49
213 0.43
214 0.35
215 0.25
216 0.2
217 0.18
218 0.17
219 0.17
220 0.16
221 0.14
222 0.14
223 0.14
224 0.13
225 0.1
226 0.1
227 0.07
228 0.06
229 0.05
230 0.05
231 0.05
232 0.06
233 0.08
234 0.1
235 0.11
236 0.12
237 0.14
238 0.15
239 0.17
240 0.19
241 0.2
242 0.22
243 0.28
244 0.35
245 0.42
246 0.43
247 0.46
248 0.51
249 0.53
250 0.51
251 0.47
252 0.46
253 0.47
254 0.51
255 0.49
256 0.44
257 0.4
258 0.39
259 0.37
260 0.31
261 0.24
262 0.24
263 0.28
264 0.34
265 0.4
266 0.42
267 0.48
268 0.53
269 0.53
270 0.49
271 0.44
272 0.37
273 0.32
274 0.31
275 0.25
276 0.2
277 0.18
278 0.16
279 0.15
280 0.13
281 0.11
282 0.12
283 0.12
284 0.11
285 0.11
286 0.1
287 0.09
288 0.07
289 0.07
290 0.05
291 0.05
292 0.04
293 0.03
294 0.03
295 0.03
296 0.02
297 0.02
298 0.02
299 0.02
300 0.02
301 0.02
302 0.03
303 0.03