Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XJB3

Protein Details
Accession K1XJB3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-120IQNLKDKRAKKEERERFEKMAETMHRKRVERLKRKEKRNKMLKSBasic
NLS Segment(s)
PositionSequence
56-120AAVKAKEKEMKDEKEAARKDKIQNLKDKRAKKEERERFEKMAETMHRKRVERLKRKEKRNKMLKS
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG mbe:MBM_01465  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSADTATPITAPTDVFAQPQGMRKNGKQWHEPKTAFRPKAGNGTYEKRQAERVAMAAVKAKEKEMKDEKEAARKDKIQNLKDKRAKKEERERFEKMAETMHRKRVERLKRKEKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.15
5 0.16
6 0.23
7 0.26
8 0.28
9 0.32
10 0.33
11 0.42
12 0.46
13 0.49
14 0.52
15 0.55
16 0.59
17 0.64
18 0.64
19 0.61
20 0.65
21 0.7
22 0.61
23 0.57
24 0.52
25 0.45
26 0.52
27 0.46
28 0.39
29 0.34
30 0.39
31 0.4
32 0.42
33 0.41
34 0.33
35 0.34
36 0.31
37 0.28
38 0.24
39 0.2
40 0.15
41 0.14
42 0.13
43 0.15
44 0.14
45 0.14
46 0.13
47 0.13
48 0.16
49 0.17
50 0.24
51 0.27
52 0.3
53 0.31
54 0.39
55 0.4
56 0.44
57 0.47
58 0.43
59 0.41
60 0.43
61 0.44
62 0.44
63 0.51
64 0.47
65 0.55
66 0.59
67 0.65
68 0.67
69 0.71
70 0.71
71 0.73
72 0.76
73 0.76
74 0.79
75 0.78
76 0.8
77 0.8
78 0.78
79 0.71
80 0.65
81 0.58
82 0.48
83 0.46
84 0.43
85 0.45
86 0.45
87 0.5
88 0.54
89 0.52
90 0.59
91 0.62
92 0.66
93 0.68
94 0.73
95 0.76
96 0.79
97 0.89
98 0.92
99 0.93
100 0.93