Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J8P7

Protein Details
Accession A0A397J8P7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-44NSNNSSSEKKVQNNKKRKYTMQDHQKDQKKAVQNNKKREYTHydrophilic
49-68QIIIKKKTSKDKLKISKTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, mito_nucl 13.666, cyto_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR021027  Transposase_put_HTH  
Pfam View protein in Pfam  
PF12323  HTH_OrfB_IS605  
Amino Acid Sequences MSNNSNNSSSEKKVQNNKKRKYTMQDHQKDQKKAVQNNKKREYTMQESQIIIKKKTSKDKLKISKTSTQTMKLSKTLIQRETLMKWFGTARLTYNQVLSAIENEGIPQNKKAFRAKCLNSENFKMKTNGIEEEILALDPGVRTFSIGYSPSGLAVEWEKNDIGRIYRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.78
4 0.83
5 0.85
6 0.86
7 0.85
8 0.84
9 0.83
10 0.83
11 0.84
12 0.83
13 0.81
14 0.83
15 0.84
16 0.77
17 0.71
18 0.68
19 0.66
20 0.66
21 0.68
22 0.69
23 0.7
24 0.77
25 0.82
26 0.78
27 0.71
28 0.68
29 0.65
30 0.62
31 0.6
32 0.55
33 0.49
34 0.46
35 0.47
36 0.47
37 0.43
38 0.36
39 0.33
40 0.34
41 0.37
42 0.47
43 0.53
44 0.57
45 0.62
46 0.72
47 0.78
48 0.79
49 0.81
50 0.76
51 0.75
52 0.68
53 0.67
54 0.59
55 0.53
56 0.48
57 0.44
58 0.41
59 0.34
60 0.32
61 0.29
62 0.33
63 0.33
64 0.31
65 0.29
66 0.28
67 0.29
68 0.3
69 0.28
70 0.22
71 0.17
72 0.16
73 0.15
74 0.14
75 0.13
76 0.11
77 0.11
78 0.13
79 0.16
80 0.16
81 0.15
82 0.15
83 0.14
84 0.13
85 0.11
86 0.1
87 0.08
88 0.07
89 0.07
90 0.07
91 0.09
92 0.11
93 0.11
94 0.13
95 0.17
96 0.19
97 0.23
98 0.31
99 0.32
100 0.36
101 0.45
102 0.47
103 0.51
104 0.57
105 0.6
106 0.56
107 0.59
108 0.59
109 0.52
110 0.51
111 0.44
112 0.37
113 0.34
114 0.32
115 0.28
116 0.23
117 0.22
118 0.19
119 0.18
120 0.18
121 0.14
122 0.11
123 0.08
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.08
132 0.11
133 0.12
134 0.13
135 0.15
136 0.15
137 0.15
138 0.15
139 0.14
140 0.12
141 0.14
142 0.17
143 0.15
144 0.17
145 0.17
146 0.17
147 0.2
148 0.2