Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J3P3

Protein Details
Accession A0A397J3P3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-39TQHYGEIKKRFKKKEPLSIGGHydrophilic
NLS Segment(s)
PositionSequence
27-32KRFKKK
Subcellular Location(s) cyto_nucl 15.5, cyto 12, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR017959  Asn/Gln-tRNA_amidoTrfase_suB/E  
IPR006075  Asn/Gln-tRNA_Trfase_suB/E_cat  
IPR014746  Gln_synth/guanido_kin_cat_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016884  F:carbon-nitrogen ligase activity, with glutamine as amido-N-donor  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF02934  GatB_N  
Amino Acid Sequences MFSFEIPIQKNLLAGYQITQHYGEIKKRFKKKEPLSIGGKIALSHLDGLKYETEVRIKQIQLEQDTGKSIYDIKPGFALMDLNRAGTEIVTEPDIRSLKEAGLNLRKLQNILCAVGSSDGRDLSLRCDVDVSVNQVGTPDVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.16
5 0.17
6 0.17
7 0.16
8 0.2
9 0.25
10 0.31
11 0.34
12 0.43
13 0.5
14 0.59
15 0.67
16 0.71
17 0.78
18 0.8
19 0.82
20 0.81
21 0.8
22 0.76
23 0.72
24 0.64
25 0.55
26 0.45
27 0.34
28 0.26
29 0.2
30 0.14
31 0.11
32 0.1
33 0.08
34 0.08
35 0.1
36 0.09
37 0.1
38 0.1
39 0.1
40 0.13
41 0.13
42 0.16
43 0.19
44 0.19
45 0.2
46 0.22
47 0.24
48 0.23
49 0.25
50 0.22
51 0.19
52 0.2
53 0.18
54 0.15
55 0.11
56 0.11
57 0.09
58 0.13
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.11
66 0.06
67 0.11
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.08
74 0.09
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.12
81 0.13
82 0.12
83 0.13
84 0.13
85 0.13
86 0.16
87 0.18
88 0.2
89 0.26
90 0.28
91 0.29
92 0.32
93 0.32
94 0.3
95 0.29
96 0.28
97 0.23
98 0.22
99 0.2
100 0.16
101 0.16
102 0.18
103 0.17
104 0.12
105 0.12
106 0.11
107 0.11
108 0.12
109 0.12
110 0.14
111 0.2
112 0.19
113 0.18
114 0.19
115 0.18
116 0.22
117 0.25
118 0.26
119 0.22
120 0.21
121 0.21
122 0.2