Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J9Y7

Protein Details
Accession A0A397J9Y7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-82ADYDLEKDSRRKKRKNSYVYQYFKLHydrophilic
NLS Segment(s)
PositionSequence
67-71RRKKR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MQQHLEISRESFFKAIKSVTNDNSIDASANSSNVHDTLKKTEWIEFDYEFVVEIGEEADYDLEKDSRRKKRKNSYVYQYFKLLVLGLFDIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.25
5 0.3
6 0.31
7 0.37
8 0.35
9 0.33
10 0.32
11 0.28
12 0.22
13 0.16
14 0.17
15 0.11
16 0.11
17 0.1
18 0.09
19 0.1
20 0.1
21 0.11
22 0.1
23 0.11
24 0.16
25 0.17
26 0.2
27 0.2
28 0.22
29 0.22
30 0.22
31 0.23
32 0.17
33 0.16
34 0.14
35 0.13
36 0.1
37 0.09
38 0.07
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.05
49 0.06
50 0.08
51 0.15
52 0.25
53 0.36
54 0.46
55 0.55
56 0.65
57 0.75
58 0.84
59 0.88
60 0.89
61 0.89
62 0.89
63 0.87
64 0.79
65 0.71
66 0.61
67 0.51
68 0.42
69 0.31
70 0.21
71 0.16