Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J1A8

Protein Details
Accession A0A397J1A8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGNKKSKLDKKNTKNQKKPSSQKEKYQYISHydrophilic
NLS Segment(s)
PositionSequence
6-18SKLDKKNTKNQKK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MGNKKSKLDKKNTKNQKKPSSQKEKYQYISGRKYHNEEKNGCKVLDLGCGIGIWEPICPSEIKPVNAEFVKSNILKGLPFKDNEFDYVHTALISKMKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.91
5 0.92
6 0.92
7 0.92
8 0.87
9 0.87
10 0.85
11 0.82
12 0.75
13 0.73
14 0.69
15 0.66
16 0.68
17 0.62
18 0.59
19 0.54
20 0.57
21 0.58
22 0.58
23 0.56
24 0.53
25 0.55
26 0.57
27 0.56
28 0.5
29 0.41
30 0.35
31 0.29
32 0.27
33 0.2
34 0.12
35 0.09
36 0.09
37 0.09
38 0.08
39 0.07
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.15
48 0.19
49 0.2
50 0.22
51 0.22
52 0.26
53 0.26
54 0.27
55 0.19
56 0.17
57 0.21
58 0.19
59 0.19
60 0.16
61 0.16
62 0.16
63 0.19
64 0.22
65 0.21
66 0.23
67 0.25
68 0.27
69 0.28
70 0.29
71 0.29
72 0.26
73 0.25
74 0.25
75 0.23
76 0.18
77 0.18
78 0.17
79 0.19