Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IB23

Protein Details
Accession A0A397IB23    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-125ANYVRPKEPKGPKGPKEPKGLKGPKGPKRPKNBasic
NLS Segment(s)
PositionSequence
97-125VRPKEPKGPKGPKEPKGLKGPKGPKRPKN
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLELKLRANSSDTLTNPDLCFENVAQFKRFLNKINYKEPIAVMSDNTKFKYSLRYSSRLGCIIGSILSNEKTKIQEYNDISRIINSIKDKKAIANYVRPKEPKGPKGPKEPKGLKGPKGPKRPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.3
4 0.3
5 0.27
6 0.21
7 0.23
8 0.16
9 0.21
10 0.23
11 0.26
12 0.26
13 0.26
14 0.27
15 0.31
16 0.33
17 0.31
18 0.36
19 0.43
20 0.47
21 0.53
22 0.55
23 0.5
24 0.5
25 0.44
26 0.36
27 0.29
28 0.24
29 0.17
30 0.17
31 0.2
32 0.2
33 0.21
34 0.21
35 0.19
36 0.19
37 0.27
38 0.25
39 0.3
40 0.33
41 0.36
42 0.37
43 0.41
44 0.43
45 0.35
46 0.32
47 0.23
48 0.18
49 0.14
50 0.12
51 0.08
52 0.06
53 0.06
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.15
61 0.16
62 0.22
63 0.26
64 0.32
65 0.33
66 0.33
67 0.32
68 0.29
69 0.28
70 0.21
71 0.22
72 0.2
73 0.25
74 0.25
75 0.28
76 0.28
77 0.3
78 0.35
79 0.38
80 0.38
81 0.41
82 0.48
83 0.51
84 0.58
85 0.56
86 0.55
87 0.58
88 0.62
89 0.62
90 0.64
91 0.68
92 0.68
93 0.78
94 0.84
95 0.82
96 0.83
97 0.8
98 0.77
99 0.77
100 0.78
101 0.74
102 0.74
103 0.77
104 0.76
105 0.81