Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GSA1

Protein Details
Accession A0A397GSA1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-103HVLRRPKGPKGPKGPKGPKEPKGPKGPKGPKGPKGPKGPKGPKRPKNBasic
NLS Segment(s)
PositionSequence
60-103RRPKGPKGPKGPKGPKEPKGPKGPKGPKGPKGPKGPKGPKRPKN
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MTLKQFGLEEHGEKQLFVSSEECNLKKINKESRKIENKVDIIWTLKSTDLEDHQIDHVLRRPKGPKGPKGPKGPKEPKGPKGPKGPKGPKGPKGPKGPKRPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.2
4 0.19
5 0.18
6 0.13
7 0.2
8 0.26
9 0.25
10 0.23
11 0.25
12 0.27
13 0.31
14 0.38
15 0.43
16 0.46
17 0.53
18 0.57
19 0.66
20 0.72
21 0.7
22 0.67
23 0.64
24 0.56
25 0.5
26 0.45
27 0.35
28 0.28
29 0.25
30 0.2
31 0.13
32 0.12
33 0.12
34 0.11
35 0.11
36 0.1
37 0.13
38 0.12
39 0.13
40 0.12
41 0.14
42 0.13
43 0.13
44 0.17
45 0.2
46 0.21
47 0.25
48 0.28
49 0.32
50 0.41
51 0.49
52 0.52
53 0.57
54 0.67
55 0.7
56 0.77
57 0.81
58 0.8
59 0.83
60 0.83
61 0.8
62 0.81
63 0.81
64 0.78
65 0.8
66 0.79
67 0.75
68 0.77
69 0.79
70 0.76
71 0.78
72 0.8
73 0.77
74 0.81
75 0.83
76 0.8
77 0.82
78 0.83
79 0.8
80 0.82
81 0.84
82 0.83
83 0.85