Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IRN4

Protein Details
Accession A0A397IRN4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-132RNELCPKSGRRKKREKWNIISFRKPSHydrophilic
NLS Segment(s)
PositionSequence
113-123KSGRRKKREKW
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MNNCIFIDSSNPNQLLNAGTIPLITPPFPPFVDLKTLIVKQPDGKIPAKAPNAFIIYRKVFIGAAREKGYYLPMPVVSSMASQAWKKEPELVKEEYKRLAKEAFDLRNELCPKSGRRKKREKWNIISFRKPSTSKSIKSSSLPTTPSVPTIPIIPLVTEPQKAPSFSSNSSTPINFNNFNKPFDQESPQYFDNIEESPSLNKIFDLGFNGNETYSTDFLTSPSYFFPESPIIYGESLNYYCDLAQNTVPSQITFEGLLESLPIESNIWQYIAAPYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.22
4 0.17
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.11
11 0.1
12 0.12
13 0.13
14 0.17
15 0.17
16 0.19
17 0.18
18 0.2
19 0.26
20 0.25
21 0.26
22 0.28
23 0.3
24 0.3
25 0.31
26 0.3
27 0.28
28 0.32
29 0.35
30 0.34
31 0.35
32 0.36
33 0.38
34 0.44
35 0.46
36 0.42
37 0.39
38 0.38
39 0.4
40 0.37
41 0.35
42 0.33
43 0.29
44 0.28
45 0.27
46 0.23
47 0.2
48 0.2
49 0.26
50 0.23
51 0.25
52 0.26
53 0.26
54 0.26
55 0.26
56 0.28
57 0.21
58 0.18
59 0.15
60 0.13
61 0.14
62 0.14
63 0.14
64 0.11
65 0.1
66 0.1
67 0.09
68 0.11
69 0.11
70 0.13
71 0.17
72 0.18
73 0.18
74 0.25
75 0.28
76 0.31
77 0.35
78 0.37
79 0.41
80 0.43
81 0.45
82 0.43
83 0.42
84 0.38
85 0.35
86 0.34
87 0.26
88 0.27
89 0.33
90 0.31
91 0.29
92 0.3
93 0.28
94 0.33
95 0.34
96 0.29
97 0.24
98 0.23
99 0.27
100 0.36
101 0.43
102 0.46
103 0.54
104 0.65
105 0.72
106 0.8
107 0.86
108 0.85
109 0.86
110 0.87
111 0.88
112 0.82
113 0.81
114 0.71
115 0.63
116 0.59
117 0.5
118 0.42
119 0.41
120 0.42
121 0.38
122 0.41
123 0.42
124 0.39
125 0.4
126 0.42
127 0.36
128 0.32
129 0.31
130 0.26
131 0.25
132 0.24
133 0.23
134 0.19
135 0.16
136 0.13
137 0.12
138 0.12
139 0.09
140 0.09
141 0.08
142 0.08
143 0.1
144 0.12
145 0.11
146 0.11
147 0.15
148 0.16
149 0.16
150 0.17
151 0.19
152 0.21
153 0.21
154 0.25
155 0.22
156 0.23
157 0.24
158 0.23
159 0.21
160 0.2
161 0.23
162 0.23
163 0.24
164 0.31
165 0.32
166 0.33
167 0.33
168 0.32
169 0.32
170 0.32
171 0.35
172 0.28
173 0.29
174 0.33
175 0.32
176 0.3
177 0.26
178 0.23
179 0.21
180 0.17
181 0.15
182 0.1
183 0.11
184 0.11
185 0.13
186 0.13
187 0.11
188 0.1
189 0.1
190 0.1
191 0.1
192 0.14
193 0.14
194 0.14
195 0.15
196 0.16
197 0.14
198 0.14
199 0.14
200 0.13
201 0.12
202 0.12
203 0.11
204 0.11
205 0.12
206 0.16
207 0.15
208 0.13
209 0.14
210 0.16
211 0.16
212 0.16
213 0.19
214 0.18
215 0.19
216 0.19
217 0.19
218 0.18
219 0.18
220 0.18
221 0.15
222 0.15
223 0.15
224 0.14
225 0.13
226 0.12
227 0.12
228 0.14
229 0.15
230 0.14
231 0.15
232 0.18
233 0.18
234 0.22
235 0.22
236 0.2
237 0.2
238 0.18
239 0.18
240 0.15
241 0.15
242 0.11
243 0.11
244 0.11
245 0.09
246 0.08
247 0.07
248 0.07
249 0.08
250 0.07
251 0.08
252 0.11
253 0.12
254 0.12
255 0.11
256 0.12