Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IIB2

Protein Details
Accession A0A397IIB2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-75RRINRIAVIKCRKKRKAKNEEIIKKVNHydrophilic
NLS Segment(s)
PositionSequence
44-67PKERKRRINRIAVIKCRKKRKAKN
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
Amino Acid Sequences MDNFRLEDIAPTPEMILFDANFTYVTEAAINDFINNLEDKGETPKERKRRINRIAVIKCRKKRKAKNEEIIKKVNALEEENSYLTNLVKQLQEEVNELKNATFLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.09
11 0.08
12 0.08
13 0.07
14 0.07
15 0.08
16 0.09
17 0.08
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.07
24 0.06
25 0.06
26 0.07
27 0.12
28 0.15
29 0.16
30 0.21
31 0.28
32 0.37
33 0.45
34 0.54
35 0.59
36 0.67
37 0.72
38 0.78
39 0.76
40 0.77
41 0.76
42 0.77
43 0.77
44 0.75
45 0.74
46 0.74
47 0.77
48 0.77
49 0.8
50 0.82
51 0.83
52 0.85
53 0.89
54 0.9
55 0.9
56 0.85
57 0.8
58 0.69
59 0.59
60 0.49
61 0.42
62 0.32
63 0.25
64 0.21
65 0.18
66 0.2
67 0.19
68 0.18
69 0.16
70 0.15
71 0.13
72 0.13
73 0.11
74 0.12
75 0.12
76 0.13
77 0.17
78 0.19
79 0.21
80 0.22
81 0.25
82 0.26
83 0.26
84 0.26
85 0.21