Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JR99

Protein Details
Accession A0A397JR99    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-70PKGPKGLKGSKGPKRPKGPKNBasic
NLS Segment(s)
PositionSequence
39-70RGPKGPKGPKGPKGPKGLKGSKGPKRPKGPKN
Subcellular Location(s) mito 21, mito_nucl 13.833, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSRMRNRSIFASAIAGLPAFTTPSTSITSRRCYQNHVLRGPKGPKGPKGPKGPKGLKGSKGPKRPKGPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.1
4 0.09
5 0.08
6 0.06
7 0.05
8 0.06
9 0.07
10 0.09
11 0.12
12 0.13
13 0.18
14 0.21
15 0.27
16 0.3
17 0.36
18 0.34
19 0.37
20 0.45
21 0.48
22 0.51
23 0.52
24 0.52
25 0.47
26 0.54
27 0.51
28 0.47
29 0.46
30 0.43
31 0.44
32 0.5
33 0.56
34 0.58
35 0.66
36 0.7
37 0.71
38 0.76
39 0.76
40 0.74
41 0.75
42 0.74
43 0.7
44 0.71
45 0.74
46 0.73
47 0.77
48 0.79
49 0.79
50 0.83