Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GJQ3

Protein Details
Accession A0A397GJQ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-84MIPSKRPNYCQQNQKTKLPTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MKQRRPNIILPVPTIPNISTINTIPIIPTTIPTILTVKSNHHHHNGSKYSEYQVFNVFDDEMIMIPSKRPNYCQQNQKTKLPTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.28
3 0.24
4 0.22
5 0.2
6 0.18
7 0.16
8 0.18
9 0.17
10 0.16
11 0.13
12 0.12
13 0.12
14 0.1
15 0.1
16 0.1
17 0.09
18 0.1
19 0.11
20 0.12
21 0.1
22 0.13
23 0.13
24 0.14
25 0.19
26 0.24
27 0.26
28 0.29
29 0.31
30 0.31
31 0.38
32 0.39
33 0.37
34 0.33
35 0.31
36 0.3
37 0.33
38 0.32
39 0.26
40 0.26
41 0.24
42 0.22
43 0.22
44 0.19
45 0.13
46 0.12
47 0.11
48 0.07
49 0.07
50 0.07
51 0.06
52 0.08
53 0.13
54 0.18
55 0.19
56 0.24
57 0.33
58 0.42
59 0.51
60 0.6
61 0.65
62 0.71
63 0.76
64 0.8