Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IJA7

Protein Details
Accession A0A397IJA7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-55KDLLLHRIKPLKKKRKKNEEKESKEPNAKIBasic
NLS Segment(s)
PositionSequence
32-49RIKPLKKKRKKNEEKESK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045864  aa-tRNA-synth_II/BPL/LPL  
Amino Acid Sequences MIKPVEIIVPKLSKELYLCSLRPALKDLLLHRIKPLKKKRKKNEEKESKEPNAKIILINDELPNISKFNVEKYFKILNKSRNYSLNYEYKFGSIVLFGEVVTSTQIFLDKQVQGRGRGENTWISPPGSVVEAMRTEPSYKEEWLALILVKFELFYKEFCENGHQIVTLETQKSENKDSWYNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.28
5 0.27
6 0.29
7 0.34
8 0.34
9 0.34
10 0.33
11 0.3
12 0.27
13 0.3
14 0.29
15 0.33
16 0.35
17 0.34
18 0.36
19 0.42
20 0.44
21 0.51
22 0.6
23 0.61
24 0.68
25 0.78
26 0.84
27 0.87
28 0.93
29 0.94
30 0.94
31 0.95
32 0.93
33 0.91
34 0.89
35 0.85
36 0.81
37 0.7
38 0.62
39 0.54
40 0.46
41 0.38
42 0.3
43 0.26
44 0.2
45 0.21
46 0.18
47 0.15
48 0.14
49 0.14
50 0.13
51 0.1
52 0.09
53 0.1
54 0.1
55 0.15
56 0.22
57 0.23
58 0.23
59 0.28
60 0.35
61 0.35
62 0.41
63 0.41
64 0.42
65 0.47
66 0.51
67 0.49
68 0.47
69 0.48
70 0.45
71 0.44
72 0.43
73 0.37
74 0.34
75 0.31
76 0.25
77 0.23
78 0.19
79 0.15
80 0.08
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.04
90 0.04
91 0.04
92 0.05
93 0.04
94 0.06
95 0.1
96 0.12
97 0.14
98 0.19
99 0.21
100 0.24
101 0.26
102 0.28
103 0.25
104 0.24
105 0.25
106 0.22
107 0.22
108 0.23
109 0.22
110 0.19
111 0.17
112 0.17
113 0.15
114 0.13
115 0.11
116 0.08
117 0.1
118 0.1
119 0.11
120 0.12
121 0.12
122 0.12
123 0.13
124 0.16
125 0.16
126 0.16
127 0.17
128 0.16
129 0.15
130 0.15
131 0.15
132 0.12
133 0.1
134 0.1
135 0.09
136 0.08
137 0.08
138 0.08
139 0.1
140 0.1
141 0.11
142 0.15
143 0.17
144 0.18
145 0.19
146 0.24
147 0.23
148 0.24
149 0.25
150 0.21
151 0.19
152 0.2
153 0.23
154 0.21
155 0.2
156 0.19
157 0.21
158 0.25
159 0.29
160 0.32
161 0.32
162 0.34