Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HJ99

Protein Details
Accession A0A397HJ99    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-96DLNTTNNKNNNKNNNKNNNKNNDKNNDKNNNKNNNKNNNKNNNKNNNNCNHydrophilic
164-187DASLKKINRYTKNSKNNINECRVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MTSNKEFAVGNKSNDNNNNEQRKYGPTLFGRNKIRKHKISCLTPSVDLNTTNNKNNNKNNNKNNNKNNDKNNDKNNNKNNNKNNNKNNNKNNNNCNVKKVKKVKFSNFIKISDAVGEYDRCGQLGRKEENFAINIRFTGETLAKTKFNMGKWVNKNIYNHQEVDASLKKINRYTKNSKNNINECRVRDNTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.51
4 0.56
5 0.62
6 0.56
7 0.56
8 0.52
9 0.5
10 0.52
11 0.46
12 0.44
13 0.39
14 0.49
15 0.53
16 0.59
17 0.64
18 0.64
19 0.7
20 0.73
21 0.78
22 0.76
23 0.77
24 0.79
25 0.78
26 0.79
27 0.76
28 0.72
29 0.65
30 0.58
31 0.52
32 0.45
33 0.38
34 0.31
35 0.26
36 0.29
37 0.29
38 0.32
39 0.37
40 0.4
41 0.46
42 0.53
43 0.62
44 0.64
45 0.7
46 0.76
47 0.8
48 0.84
49 0.87
50 0.87
51 0.86
52 0.85
53 0.82
54 0.8
55 0.78
56 0.76
57 0.74
58 0.75
59 0.75
60 0.71
61 0.73
62 0.75
63 0.76
64 0.75
65 0.77
66 0.77
67 0.77
68 0.82
69 0.82
70 0.83
71 0.83
72 0.86
73 0.87
74 0.88
75 0.87
76 0.86
77 0.83
78 0.78
79 0.76
80 0.74
81 0.65
82 0.6
83 0.58
84 0.53
85 0.55
86 0.59
87 0.58
88 0.6
89 0.67
90 0.68
91 0.7
92 0.72
93 0.73
94 0.66
95 0.6
96 0.52
97 0.45
98 0.37
99 0.28
100 0.24
101 0.14
102 0.13
103 0.11
104 0.1
105 0.11
106 0.11
107 0.1
108 0.1
109 0.11
110 0.15
111 0.23
112 0.26
113 0.26
114 0.28
115 0.29
116 0.31
117 0.3
118 0.27
119 0.22
120 0.17
121 0.16
122 0.15
123 0.14
124 0.12
125 0.14
126 0.13
127 0.13
128 0.16
129 0.19
130 0.17
131 0.18
132 0.24
133 0.25
134 0.25
135 0.32
136 0.33
137 0.41
138 0.46
139 0.55
140 0.54
141 0.54
142 0.57
143 0.56
144 0.6
145 0.53
146 0.49
147 0.41
148 0.38
149 0.34
150 0.37
151 0.33
152 0.28
153 0.28
154 0.29
155 0.3
156 0.35
157 0.44
158 0.46
159 0.51
160 0.58
161 0.65
162 0.74
163 0.79
164 0.82
165 0.83
166 0.83
167 0.83
168 0.82
169 0.79
170 0.73
171 0.74