Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J5Z7

Protein Details
Accession A0A397J5Z7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
69-90GGGGKESRKEEKKRREYKRNNNBasic
NLS Segment(s)
PositionSequence
51-88GSKEGGKQIGGREGGGKEGGGGKESRKEEKKRREYKRN
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MKTTQSAIDSLRELNSKLTSQIVELRKEKDSLIDKNAELLAKESVLKRNEGSKEGGKQIGGREGGGKEGGGGKESRKEEKKRREYKRNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.19
5 0.2
6 0.17
7 0.17
8 0.24
9 0.25
10 0.29
11 0.31
12 0.33
13 0.32
14 0.33
15 0.31
16 0.3
17 0.32
18 0.29
19 0.3
20 0.3
21 0.28
22 0.29
23 0.3
24 0.23
25 0.18
26 0.15
27 0.11
28 0.09
29 0.1
30 0.1
31 0.15
32 0.15
33 0.16
34 0.16
35 0.21
36 0.23
37 0.23
38 0.26
39 0.24
40 0.27
41 0.29
42 0.29
43 0.23
44 0.23
45 0.22
46 0.24
47 0.2
48 0.17
49 0.17
50 0.16
51 0.17
52 0.15
53 0.14
54 0.09
55 0.13
56 0.13
57 0.12
58 0.13
59 0.14
60 0.21
61 0.25
62 0.33
63 0.38
64 0.48
65 0.57
66 0.68
67 0.77
68 0.8
69 0.88
70 0.9