Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HW45

Protein Details
Accession A0A397HW45    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-47LSGTLPISSKRQKNPKKQKNLKEIKKRKSKKNDKYKGEKGKEGBasic
NLS Segment(s)
PositionSequence
14-45KRQKNPKKQKNLKEIKKRKSKKNDKYKGEKGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MFHSLSGTLPISSKRQKNPKKQKNLKEIKKRKSKKNDKYKGEKGKEGNEGEESEDDDDEDEKGEKYKEGADKEYHNKIVNIKSEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.53
3 0.63
4 0.72
5 0.81
6 0.85
7 0.88
8 0.91
9 0.92
10 0.92
11 0.93
12 0.92
13 0.92
14 0.92
15 0.9
16 0.91
17 0.9
18 0.89
19 0.89
20 0.9
21 0.89
22 0.9
23 0.9
24 0.88
25 0.89
26 0.89
27 0.88
28 0.81
29 0.76
30 0.67
31 0.62
32 0.59
33 0.5
34 0.42
35 0.32
36 0.29
37 0.25
38 0.22
39 0.17
40 0.12
41 0.11
42 0.09
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.1
51 0.09
52 0.1
53 0.16
54 0.21
55 0.25
56 0.29
57 0.31
58 0.38
59 0.45
60 0.51
61 0.49
62 0.46
63 0.45
64 0.46
65 0.5