Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H631

Protein Details
Accession A0A397H631    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-37IASNSNPTRKRGRPKKEKASTTSTSHydrophilic
42-65TTPMATPPRKRGRPRKIQKSDDIPHydrophilic
NLS Segment(s)
PositionSequence
21-30RKRGRPKKEK
49-60PRKRGRPRKIQK
Subcellular Location(s) nucl 25, cyto_nucl 14.833, mito_nucl 13.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MNNMNKSTSTIDIASNSNPTRKRGRPKKEKASTTSTSTTTTTTPMATPPRKRGRPRKIQKSDDIPDYKKIAKIKEYIKKHVPSVTKDTEDNVSEKSKKMAQELWDKVNDYEQKYLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.28
5 0.3
6 0.33
7 0.39
8 0.46
9 0.55
10 0.6
11 0.69
12 0.74
13 0.82
14 0.89
15 0.9
16 0.89
17 0.84
18 0.81
19 0.74
20 0.69
21 0.61
22 0.51
23 0.43
24 0.36
25 0.32
26 0.24
27 0.22
28 0.16
29 0.14
30 0.13
31 0.14
32 0.22
33 0.27
34 0.3
35 0.38
36 0.48
37 0.55
38 0.64
39 0.71
40 0.73
41 0.78
42 0.84
43 0.86
44 0.86
45 0.84
46 0.81
47 0.78
48 0.71
49 0.68
50 0.62
51 0.53
52 0.46
53 0.44
54 0.39
55 0.34
56 0.34
57 0.29
58 0.28
59 0.32
60 0.38
61 0.44
62 0.48
63 0.52
64 0.57
65 0.56
66 0.55
67 0.55
68 0.51
69 0.48
70 0.5
71 0.48
72 0.43
73 0.4
74 0.4
75 0.37
76 0.34
77 0.3
78 0.25
79 0.25
80 0.25
81 0.25
82 0.27
83 0.27
84 0.28
85 0.31
86 0.33
87 0.34
88 0.43
89 0.47
90 0.49
91 0.49
92 0.49
93 0.45
94 0.48
95 0.47
96 0.4