Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HL24

Protein Details
Accession A0A397HL24    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPLTKVLRAAKKRKIKRNASGKFISHydrophilic
NLS Segment(s)
PositionSequence
8-20RAAKKRKIKRNAS
Subcellular Location(s) nucl 19, cyto_nucl 13.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MPLTKVLRAAKKRKIKRNASGKFISNKHNNNESDFSAYSEENEESEYDSDEYLKQRRKYLSEFDLIITIMKLIMKRFLLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.88
5 0.85
6 0.82
7 0.77
8 0.72
9 0.69
10 0.63
11 0.61
12 0.58
13 0.57
14 0.55
15 0.57
16 0.52
17 0.49
18 0.48
19 0.41
20 0.36
21 0.31
22 0.27
23 0.21
24 0.2
25 0.16
26 0.15
27 0.13
28 0.09
29 0.1
30 0.08
31 0.08
32 0.08
33 0.09
34 0.07
35 0.07
36 0.08
37 0.09
38 0.12
39 0.18
40 0.25
41 0.27
42 0.33
43 0.37
44 0.41
45 0.45
46 0.49
47 0.48
48 0.45
49 0.43
50 0.38
51 0.35
52 0.3
53 0.25
54 0.17
55 0.12
56 0.08
57 0.09
58 0.1
59 0.1
60 0.15
61 0.15