Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WBU3

Protein Details
Accession K1WBU3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
278-299WFPGRWPTARRRRGGNESRQLVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
KEGG mbe:MBM_07056  -  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MDSQPPPSRGYVDPNFPNPNGPGDASVIIYGYTPNFIICILGIVFFAFIFFAHLLQIIIYRLWSFTPLGFACVMEVIGYVFRELSSRKDPYRVNFFVVQYFLIVTAPVLISASIYVCLAKVLGWAADSGLDLSARSVLFRRTFALSTFITIDVLSTLLQVAGASMIGVATSNGKNPTTANNILLAGLAVQTAAFFVFLGLLAFATAAIYRDRRVARKAKRSPFLGVLVVASVLIFVRTIFRLAETAQGVFGYLSSDERYFAVLEFVPVVLAAGILAVWFPGRWPTARRRRGGNESRQLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.5
4 0.52
5 0.44
6 0.42
7 0.36
8 0.31
9 0.26
10 0.23
11 0.23
12 0.2
13 0.18
14 0.14
15 0.12
16 0.11
17 0.1
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.04
35 0.04
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.09
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.1
51 0.09
52 0.08
53 0.14
54 0.13
55 0.15
56 0.15
57 0.14
58 0.13
59 0.12
60 0.12
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.05
67 0.05
68 0.05
69 0.07
70 0.08
71 0.13
72 0.19
73 0.24
74 0.25
75 0.32
76 0.35
77 0.39
78 0.48
79 0.44
80 0.42
81 0.41
82 0.41
83 0.36
84 0.34
85 0.28
86 0.18
87 0.16
88 0.12
89 0.08
90 0.07
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.06
121 0.05
122 0.06
123 0.06
124 0.1
125 0.11
126 0.12
127 0.14
128 0.14
129 0.15
130 0.15
131 0.18
132 0.15
133 0.15
134 0.15
135 0.13
136 0.11
137 0.1
138 0.09
139 0.06
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.05
157 0.05
158 0.07
159 0.09
160 0.09
161 0.1
162 0.11
163 0.14
164 0.18
165 0.2
166 0.19
167 0.18
168 0.18
169 0.18
170 0.17
171 0.13
172 0.07
173 0.06
174 0.05
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.02
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.06
195 0.07
196 0.08
197 0.14
198 0.18
199 0.22
200 0.29
201 0.38
202 0.46
203 0.56
204 0.66
205 0.69
206 0.72
207 0.72
208 0.69
209 0.64
210 0.57
211 0.47
212 0.37
213 0.28
214 0.21
215 0.18
216 0.13
217 0.08
218 0.05
219 0.04
220 0.04
221 0.03
222 0.03
223 0.06
224 0.06
225 0.08
226 0.08
227 0.09
228 0.1
229 0.11
230 0.16
231 0.15
232 0.15
233 0.14
234 0.14
235 0.13
236 0.12
237 0.11
238 0.07
239 0.07
240 0.08
241 0.1
242 0.1
243 0.11
244 0.11
245 0.12
246 0.12
247 0.11
248 0.13
249 0.11
250 0.11
251 0.11
252 0.1
253 0.09
254 0.08
255 0.08
256 0.05
257 0.05
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.04
267 0.08
268 0.11
269 0.14
270 0.21
271 0.32
272 0.43
273 0.52
274 0.57
275 0.62
276 0.69
277 0.77
278 0.81
279 0.81