Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J7Q6

Protein Details
Accession A0A397J7Q6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-57FYYLPCTKKNREKNENNHGNHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSEKISEYRIDNNNDKEKNIDGTYTYNSVGFCTLYLFYYLPCTKKNREKNENNHGNHRNHHMNEDLNENFSNHEKNKRHLLQITNNQDVPILNNIRLQIVDPRIRQLIVTFFLEIRDKCDMGYLREMKALEGLSAPVDKND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.48
4 0.44
5 0.42
6 0.36
7 0.29
8 0.22
9 0.24
10 0.26
11 0.25
12 0.23
13 0.19
14 0.18
15 0.17
16 0.16
17 0.13
18 0.1
19 0.09
20 0.09
21 0.09
22 0.1
23 0.1
24 0.09
25 0.16
26 0.19
27 0.19
28 0.22
29 0.27
30 0.33
31 0.43
32 0.53
33 0.56
34 0.65
35 0.72
36 0.78
37 0.84
38 0.86
39 0.79
40 0.79
41 0.76
42 0.68
43 0.61
44 0.58
45 0.54
46 0.44
47 0.43
48 0.36
49 0.3
50 0.28
51 0.3
52 0.24
53 0.19
54 0.18
55 0.16
56 0.15
57 0.14
58 0.16
59 0.13
60 0.22
61 0.23
62 0.26
63 0.35
64 0.37
65 0.4
66 0.41
67 0.45
68 0.45
69 0.52
70 0.56
71 0.49
72 0.47
73 0.43
74 0.38
75 0.32
76 0.26
77 0.22
78 0.17
79 0.14
80 0.16
81 0.16
82 0.16
83 0.16
84 0.16
85 0.15
86 0.2
87 0.25
88 0.24
89 0.27
90 0.27
91 0.28
92 0.27
93 0.23
94 0.21
95 0.17
96 0.18
97 0.16
98 0.15
99 0.17
100 0.21
101 0.2
102 0.2
103 0.21
104 0.2
105 0.18
106 0.25
107 0.25
108 0.25
109 0.35
110 0.33
111 0.31
112 0.35
113 0.35
114 0.29
115 0.3
116 0.26
117 0.17
118 0.15
119 0.14
120 0.13
121 0.15