Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IPX7

Protein Details
Accession A0A397IPX7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
49-68NEKLPKPKKNKSSKIPAGKTHydrophilic
NLS Segment(s)
PositionSequence
53-63PKPKKNKSSKI
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021027  Transposase_put_HTH  
Pfam View protein in Pfam  
PF12323  HTH_OrfB_IS605  
Amino Acid Sequences MGLGSWYSVRMSVLKVVKPENLRKTYSQSSRYLWQDIIECIPPPIVEENEKLPKPKKNKSSKIPAGKTQRICLFPTQEEKSKLKRWMGTVRWTYNRCLVAVEKEGIERTKKALRAQCLNAANFNNTELQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.3
4 0.35
5 0.41
6 0.48
7 0.5
8 0.5
9 0.51
10 0.51
11 0.55
12 0.59
13 0.59
14 0.56
15 0.51
16 0.5
17 0.53
18 0.53
19 0.48
20 0.39
21 0.33
22 0.29
23 0.26
24 0.25
25 0.19
26 0.16
27 0.14
28 0.14
29 0.12
30 0.11
31 0.12
32 0.11
33 0.12
34 0.13
35 0.18
36 0.24
37 0.25
38 0.27
39 0.29
40 0.35
41 0.41
42 0.48
43 0.53
44 0.57
45 0.65
46 0.7
47 0.76
48 0.79
49 0.81
50 0.76
51 0.74
52 0.72
53 0.69
54 0.63
55 0.56
56 0.52
57 0.44
58 0.42
59 0.37
60 0.32
61 0.27
62 0.32
63 0.31
64 0.32
65 0.35
66 0.37
67 0.4
68 0.44
69 0.47
70 0.45
71 0.45
72 0.46
73 0.51
74 0.52
75 0.55
76 0.55
77 0.56
78 0.59
79 0.57
80 0.54
81 0.51
82 0.47
83 0.38
84 0.33
85 0.29
86 0.26
87 0.27
88 0.26
89 0.2
90 0.2
91 0.22
92 0.23
93 0.24
94 0.2
95 0.21
96 0.26
97 0.3
98 0.37
99 0.42
100 0.47
101 0.52
102 0.56
103 0.6
104 0.59
105 0.57
106 0.54
107 0.5
108 0.45
109 0.37