Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GHL6

Protein Details
Accession A0A397GHL6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-57EIVSTKKSQNKKVKKANGKKDKDYHydrophilic
NLS Segment(s)
PositionSequence
39-55KKSQNKKVKKANGKKDK
Subcellular Location(s) nucl 21, cyto_nucl 15, cyto 5
Family & Domain DBs
Amino Acid Sequences MPESQNINNLIDIFPTLFNDSQLYSSSSKKHASEIVSTKKSQNKKVKKANGKKDKDYSMLKKLIEKLKLSSLSSNTTSQTEYITSPNNFTNLYNVIIKVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.13
5 0.14
6 0.14
7 0.14
8 0.14
9 0.15
10 0.16
11 0.15
12 0.18
13 0.2
14 0.23
15 0.26
16 0.26
17 0.27
18 0.28
19 0.28
20 0.32
21 0.37
22 0.42
23 0.41
24 0.42
25 0.44
26 0.47
27 0.5
28 0.53
29 0.56
30 0.57
31 0.64
32 0.73
33 0.78
34 0.82
35 0.86
36 0.87
37 0.87
38 0.83
39 0.79
40 0.74
41 0.68
42 0.62
43 0.59
44 0.54
45 0.51
46 0.49
47 0.43
48 0.41
49 0.44
50 0.45
51 0.42
52 0.38
53 0.33
54 0.36
55 0.38
56 0.36
57 0.33
58 0.3
59 0.3
60 0.31
61 0.3
62 0.25
63 0.23
64 0.23
65 0.19
66 0.18
67 0.16
68 0.14
69 0.16
70 0.21
71 0.2
72 0.22
73 0.23
74 0.24
75 0.23
76 0.22
77 0.23
78 0.19
79 0.22
80 0.21
81 0.2