Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IW45

Protein Details
Accession A0A397IW45    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33SAYHTNKKKRTADQAFRNDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MLKSVTSKISCNLSAYHTNKKKRTADQAFRNDDYDYLYGIVSTATEWHFIMFATDGLYCTSKSEYQINLSKMALKEDVNSIRKGVKASIGCYRWLIKRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.45
4 0.48
5 0.56
6 0.6
7 0.68
8 0.69
9 0.67
10 0.74
11 0.74
12 0.75
13 0.76
14 0.8
15 0.78
16 0.72
17 0.66
18 0.55
19 0.45
20 0.38
21 0.28
22 0.18
23 0.12
24 0.11
25 0.09
26 0.09
27 0.08
28 0.05
29 0.04
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.08
47 0.1
48 0.1
49 0.12
50 0.15
51 0.16
52 0.21
53 0.27
54 0.27
55 0.27
56 0.27
57 0.29
58 0.26
59 0.27
60 0.23
61 0.17
62 0.17
63 0.22
64 0.3
65 0.29
66 0.29
67 0.28
68 0.29
69 0.3
70 0.3
71 0.25
72 0.24
73 0.24
74 0.27
75 0.35
76 0.34
77 0.34
78 0.36
79 0.39
80 0.38