Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WEB1

Protein Details
Accession K1WEB1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEAKAKKAPKGRTEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
3-27KEAKAKKAPKGRTEKKKKDPNAPKR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG mbe:MBM_05761  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEAKAKKAPKGRTEKKKKDPNAPKRGLSAYMFFANEQRENVREENPGITFGQVGKVLGERWKALNDKQRTPYEAKAAQDKKRYEDEKASYNADAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.89
4 0.9
5 0.92
6 0.9
7 0.9
8 0.9
9 0.9
10 0.9
11 0.85
12 0.77
13 0.71
14 0.66
15 0.58
16 0.48
17 0.39
18 0.31
19 0.27
20 0.25
21 0.2
22 0.2
23 0.2
24 0.18
25 0.17
26 0.16
27 0.15
28 0.17
29 0.19
30 0.18
31 0.17
32 0.17
33 0.17
34 0.16
35 0.16
36 0.13
37 0.12
38 0.1
39 0.08
40 0.09
41 0.07
42 0.07
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.11
49 0.12
50 0.15
51 0.17
52 0.22
53 0.31
54 0.34
55 0.4
56 0.46
57 0.48
58 0.49
59 0.51
60 0.49
61 0.48
62 0.46
63 0.42
64 0.45
65 0.49
66 0.51
67 0.55
68 0.54
69 0.51
70 0.56
71 0.57
72 0.53
73 0.55
74 0.52
75 0.51
76 0.53
77 0.51
78 0.42
79 0.4
80 0.34
81 0.26
82 0.22