Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IPQ4

Protein Details
Accession A0A397IPQ4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-31AWKAKFVKKYCNTRFKRLVKRVEIQVHydrophilic
91-123ESSDKKEEEKKPKKTVFKKKKKEAKVIFNPAYNHydrophilic
NLS Segment(s)
PositionSequence
80-115SRKQKSKKKIVESSDKKEEEKKPKKTVFKKKKKEAK
Subcellular Location(s) mito 12.5, nucl 11.5, cyto_mito 8.333, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MTDWAAWKAKFVKKYCNTRFKRLVKRVEIQVDQRKRLFIKRLLPHIALLVIMQTPATLAATLELAQVYEKGLDMVNKIESRKQKSKKKIVESSDKKEEEKKPKKTVFKKKKKEAKVIFNPAYNLNNLIKKFEKMQLNLIQKIEKLTTQVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.76
4 0.77
5 0.78
6 0.85
7 0.84
8 0.86
9 0.84
10 0.84
11 0.81
12 0.81
13 0.79
14 0.76
15 0.7
16 0.68
17 0.69
18 0.66
19 0.64
20 0.58
21 0.54
22 0.49
23 0.51
24 0.5
25 0.47
26 0.49
27 0.51
28 0.57
29 0.58
30 0.56
31 0.5
32 0.42
33 0.36
34 0.26
35 0.19
36 0.12
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.06
61 0.07
62 0.09
63 0.1
64 0.11
65 0.15
66 0.21
67 0.28
68 0.38
69 0.46
70 0.53
71 0.62
72 0.72
73 0.76
74 0.79
75 0.8
76 0.77
77 0.79
78 0.78
79 0.75
80 0.74
81 0.67
82 0.59
83 0.58
84 0.6
85 0.6
86 0.62
87 0.64
88 0.65
89 0.71
90 0.8
91 0.83
92 0.86
93 0.86
94 0.87
95 0.89
96 0.9
97 0.92
98 0.91
99 0.91
100 0.89
101 0.89
102 0.88
103 0.87
104 0.8
105 0.73
106 0.65
107 0.58
108 0.5
109 0.4
110 0.33
111 0.27
112 0.28
113 0.26
114 0.3
115 0.29
116 0.29
117 0.32
118 0.36
119 0.4
120 0.37
121 0.44
122 0.48
123 0.53
124 0.55
125 0.53
126 0.49
127 0.42
128 0.43
129 0.37
130 0.29