Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HVX7

Protein Details
Accession A0A397HVX7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
242-267IGIHGRSVRRSLRKRIRVFKKFAVSNHydrophilic
NLS Segment(s)
PositionSequence
250-258RRSLRKRIR
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MLSSVRLAFKVVKPTTPIVSKFLSLNKISQIKSFQTAAVTAQKNLFSNLSTTRSLVNNNFIKPGIIYFKNHLATVADTPSSDGKLSVEELDKLFASEKEFYRANFLQVNLELLEDFPKWIETLGLKSCLPYFEGMKWQDAIKMDSNALKAKGCVSFFIRSRLLRHFDMVKCKLEGKEHNPASSEWKEPVEEGTETTYDAKMLDDIPSFLHSLGGSLGIFASYFHDKTWKDIIRMTEPEFKEIGIHGRSVRRSLRKRIRVFKKFAVSNGLIEDFPDPEPPTPEGEGERVQTQSYSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.46
4 0.44
5 0.38
6 0.38
7 0.36
8 0.35
9 0.37
10 0.37
11 0.32
12 0.32
13 0.36
14 0.4
15 0.39
16 0.4
17 0.4
18 0.37
19 0.39
20 0.38
21 0.31
22 0.26
23 0.26
24 0.26
25 0.29
26 0.28
27 0.25
28 0.27
29 0.28
30 0.27
31 0.28
32 0.26
33 0.18
34 0.19
35 0.22
36 0.23
37 0.22
38 0.22
39 0.23
40 0.24
41 0.28
42 0.27
43 0.32
44 0.32
45 0.32
46 0.33
47 0.31
48 0.29
49 0.25
50 0.25
51 0.23
52 0.2
53 0.22
54 0.23
55 0.3
56 0.31
57 0.3
58 0.28
59 0.23
60 0.22
61 0.22
62 0.21
63 0.14
64 0.13
65 0.14
66 0.15
67 0.14
68 0.12
69 0.1
70 0.09
71 0.09
72 0.11
73 0.11
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.12
80 0.12
81 0.11
82 0.12
83 0.15
84 0.16
85 0.18
86 0.19
87 0.19
88 0.26
89 0.25
90 0.25
91 0.23
92 0.23
93 0.21
94 0.2
95 0.22
96 0.14
97 0.13
98 0.11
99 0.08
100 0.1
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.06
109 0.09
110 0.11
111 0.13
112 0.13
113 0.14
114 0.14
115 0.13
116 0.13
117 0.11
118 0.11
119 0.1
120 0.17
121 0.17
122 0.18
123 0.18
124 0.17
125 0.18
126 0.18
127 0.19
128 0.14
129 0.14
130 0.14
131 0.15
132 0.16
133 0.16
134 0.15
135 0.13
136 0.11
137 0.12
138 0.14
139 0.12
140 0.13
141 0.14
142 0.18
143 0.19
144 0.24
145 0.25
146 0.23
147 0.26
148 0.3
149 0.31
150 0.28
151 0.29
152 0.31
153 0.3
154 0.38
155 0.38
156 0.35
157 0.31
158 0.33
159 0.32
160 0.31
161 0.34
162 0.31
163 0.38
164 0.37
165 0.37
166 0.36
167 0.36
168 0.37
169 0.34
170 0.3
171 0.22
172 0.21
173 0.21
174 0.19
175 0.2
176 0.16
177 0.13
178 0.12
179 0.13
180 0.12
181 0.12
182 0.13
183 0.12
184 0.09
185 0.09
186 0.08
187 0.07
188 0.07
189 0.09
190 0.08
191 0.09
192 0.09
193 0.1
194 0.11
195 0.1
196 0.1
197 0.08
198 0.08
199 0.08
200 0.08
201 0.06
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.08
208 0.1
209 0.11
210 0.11
211 0.17
212 0.18
213 0.22
214 0.32
215 0.33
216 0.31
217 0.35
218 0.4
219 0.4
220 0.44
221 0.45
222 0.44
223 0.4
224 0.42
225 0.38
226 0.33
227 0.27
228 0.24
229 0.25
230 0.18
231 0.19
232 0.2
233 0.26
234 0.28
235 0.33
236 0.4
237 0.45
238 0.51
239 0.6
240 0.68
241 0.72
242 0.8
243 0.85
244 0.88
245 0.87
246 0.87
247 0.85
248 0.84
249 0.77
250 0.7
251 0.67
252 0.58
253 0.5
254 0.45
255 0.38
256 0.28
257 0.25
258 0.24
259 0.17
260 0.16
261 0.18
262 0.17
263 0.17
264 0.21
265 0.22
266 0.25
267 0.24
268 0.26
269 0.25
270 0.27
271 0.28
272 0.27
273 0.29
274 0.25
275 0.24