Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HQ20

Protein Details
Accession A0A397HQ20    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-23VVFKRSRISRLNRINSRINFHydrophilic
178-204DYDDKTLPKKIKRKKKEKIEPPPPIEIBasic
NLS Segment(s)
PositionSequence
185-197PKKIKRKKKEKIE
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR029028  Alpha/beta_knot_MTases  
IPR001537  SpoU_MeTrfase  
IPR029026  tRNA_m1G_MTases_N  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF00588  SpoU_methylase  
CDD cd18095  SpoU-like_rRNA-MTase  
Amino Acid Sequences MISVVFKRSRISRLNRINSRINFNKFNQKCFYDTLETNSRRDSFYDNRQLNSKFPSDNKFSVGRNDFQRRPSNFDRRSNFDRGSNFDRGSNFDRGSKFDRRSNDRGSNFNRGSNFERGSNFEKGSNFERGRPDNREWNESRDFSKKDFGKKIENLELEDLKKTDKVDEIGKFKSDFGDYDDKTLPKKIKRKKKEKIEPPPPIEIPGFVRIEGARQNMVVYFEELRRDNPKRRKFRSLMIHGLKYLQEMLRRGFTVRSIGITTNDGINSPDELLGGCKEVYKNKEKYPSERYYVTNVEWTRKILGSDARVDAREVWAELPFPNIQFPEKVNKLLVLDHVASPVDMGILIRSAKALHWDASYLIAGTVDLYDDKVIRTSGCESLDWPSKTGFWQDIYDIARRNNLTLVIADTLPHNIIPKKSPNNLCFWDPMTQEVVDMTPSKIALVLGSKMHGVTYRDAREGIIRVSIPMCNNVNSMNVGMAGNILMYELNRLMDSKATNEDQIKLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.8
4 0.81
5 0.77
6 0.78
7 0.76
8 0.72
9 0.68
10 0.65
11 0.7
12 0.63
13 0.65
14 0.62
15 0.56
16 0.53
17 0.5
18 0.51
19 0.46
20 0.45
21 0.45
22 0.49
23 0.49
24 0.47
25 0.49
26 0.44
27 0.38
28 0.39
29 0.39
30 0.36
31 0.44
32 0.52
33 0.5
34 0.5
35 0.56
36 0.56
37 0.53
38 0.51
39 0.45
40 0.4
41 0.42
42 0.46
43 0.46
44 0.47
45 0.47
46 0.46
47 0.43
48 0.47
49 0.47
50 0.46
51 0.48
52 0.55
53 0.55
54 0.58
55 0.66
56 0.6
57 0.64
58 0.68
59 0.69
60 0.69
61 0.74
62 0.72
63 0.71
64 0.74
65 0.73
66 0.66
67 0.6
68 0.56
69 0.53
70 0.54
71 0.52
72 0.46
73 0.42
74 0.4
75 0.4
76 0.41
77 0.4
78 0.35
79 0.34
80 0.35
81 0.37
82 0.42
83 0.45
84 0.45
85 0.44
86 0.52
87 0.55
88 0.6
89 0.65
90 0.68
91 0.62
92 0.66
93 0.66
94 0.68
95 0.61
96 0.58
97 0.51
98 0.46
99 0.47
100 0.45
101 0.42
102 0.35
103 0.35
104 0.35
105 0.39
106 0.38
107 0.35
108 0.31
109 0.3
110 0.3
111 0.32
112 0.37
113 0.33
114 0.33
115 0.39
116 0.42
117 0.47
118 0.5
119 0.51
120 0.52
121 0.54
122 0.57
123 0.52
124 0.53
125 0.53
126 0.48
127 0.47
128 0.45
129 0.44
130 0.38
131 0.44
132 0.42
133 0.45
134 0.51
135 0.51
136 0.53
137 0.55
138 0.59
139 0.57
140 0.54
141 0.47
142 0.43
143 0.42
144 0.35
145 0.32
146 0.26
147 0.19
148 0.19
149 0.18
150 0.16
151 0.15
152 0.16
153 0.21
154 0.26
155 0.3
156 0.3
157 0.31
158 0.3
159 0.27
160 0.27
161 0.22
162 0.16
163 0.18
164 0.25
165 0.23
166 0.26
167 0.29
168 0.28
169 0.29
170 0.33
171 0.34
172 0.34
173 0.43
174 0.48
175 0.56
176 0.67
177 0.77
178 0.82
179 0.87
180 0.9
181 0.91
182 0.93
183 0.93
184 0.91
185 0.84
186 0.8
187 0.68
188 0.6
189 0.49
190 0.39
191 0.31
192 0.26
193 0.22
194 0.16
195 0.17
196 0.14
197 0.16
198 0.18
199 0.16
200 0.11
201 0.11
202 0.11
203 0.11
204 0.13
205 0.11
206 0.1
207 0.1
208 0.11
209 0.14
210 0.14
211 0.16
212 0.22
213 0.27
214 0.35
215 0.43
216 0.52
217 0.6
218 0.66
219 0.74
220 0.69
221 0.72
222 0.73
223 0.7
224 0.7
225 0.64
226 0.59
227 0.49
228 0.47
229 0.39
230 0.29
231 0.23
232 0.15
233 0.12
234 0.13
235 0.14
236 0.14
237 0.15
238 0.15
239 0.14
240 0.13
241 0.13
242 0.12
243 0.12
244 0.11
245 0.12
246 0.12
247 0.12
248 0.12
249 0.1
250 0.1
251 0.09
252 0.08
253 0.08
254 0.08
255 0.07
256 0.07
257 0.06
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.07
264 0.08
265 0.12
266 0.17
267 0.25
268 0.29
269 0.33
270 0.42
271 0.44
272 0.49
273 0.54
274 0.54
275 0.5
276 0.49
277 0.46
278 0.41
279 0.41
280 0.36
281 0.33
282 0.29
283 0.29
284 0.26
285 0.25
286 0.23
287 0.21
288 0.2
289 0.16
290 0.19
291 0.18
292 0.2
293 0.21
294 0.2
295 0.2
296 0.2
297 0.18
298 0.16
299 0.14
300 0.11
301 0.1
302 0.09
303 0.09
304 0.09
305 0.11
306 0.1
307 0.1
308 0.11
309 0.11
310 0.12
311 0.12
312 0.14
313 0.2
314 0.21
315 0.23
316 0.22
317 0.22
318 0.22
319 0.22
320 0.21
321 0.16
322 0.16
323 0.14
324 0.14
325 0.13
326 0.12
327 0.11
328 0.09
329 0.05
330 0.04
331 0.04
332 0.03
333 0.05
334 0.05
335 0.05
336 0.05
337 0.06
338 0.06
339 0.11
340 0.13
341 0.13
342 0.13
343 0.14
344 0.14
345 0.15
346 0.15
347 0.11
348 0.09
349 0.07
350 0.06
351 0.06
352 0.06
353 0.04
354 0.04
355 0.05
356 0.06
357 0.06
358 0.07
359 0.07
360 0.08
361 0.08
362 0.1
363 0.13
364 0.16
365 0.17
366 0.17
367 0.17
368 0.22
369 0.31
370 0.29
371 0.27
372 0.24
373 0.23
374 0.25
375 0.27
376 0.23
377 0.17
378 0.18
379 0.18
380 0.22
381 0.24
382 0.26
383 0.26
384 0.24
385 0.28
386 0.26
387 0.27
388 0.24
389 0.22
390 0.19
391 0.17
392 0.18
393 0.14
394 0.14
395 0.13
396 0.12
397 0.12
398 0.12
399 0.11
400 0.13
401 0.14
402 0.17
403 0.23
404 0.31
405 0.38
406 0.46
407 0.55
408 0.54
409 0.59
410 0.6
411 0.58
412 0.52
413 0.47
414 0.43
415 0.35
416 0.34
417 0.29
418 0.25
419 0.22
420 0.2
421 0.17
422 0.13
423 0.14
424 0.12
425 0.11
426 0.11
427 0.11
428 0.11
429 0.1
430 0.1
431 0.11
432 0.13
433 0.13
434 0.14
435 0.14
436 0.14
437 0.14
438 0.17
439 0.17
440 0.2
441 0.28
442 0.3
443 0.32
444 0.32
445 0.32
446 0.33
447 0.33
448 0.28
449 0.24
450 0.21
451 0.21
452 0.22
453 0.24
454 0.21
455 0.25
456 0.26
457 0.23
458 0.24
459 0.23
460 0.24
461 0.22
462 0.21
463 0.15
464 0.14
465 0.13
466 0.11
467 0.1
468 0.08
469 0.07
470 0.06
471 0.06
472 0.05
473 0.05
474 0.08
475 0.08
476 0.09
477 0.1
478 0.11
479 0.12
480 0.16
481 0.18
482 0.18
483 0.24
484 0.25
485 0.3
486 0.32
487 0.33