Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J1B3

Protein Details
Accession A0A397J1B3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-71IKMLQRCHRSCHRKKKRRRRAVDFMMQGBasic
NLS Segment(s)
PositionSequence
56-63RKKKRRRR
Subcellular Location(s) nucl 16.5, mito_nucl 13, mito 8.5
Family & Domain DBs
Amino Acid Sequences MNTVYQINNHLTWAAQKHDVITKLLPLLKRKINKKYKVTGAEIIKMLQRCHRSCHRKKKRRRRAVDFMMQGGNKYIKRYLKKDLIKILNNSSYHLEEWKETNEGTTIIDSDNDTNNNNNNTSENFLYWRFSVPITFVNITFMLEIFEDYRSKILRSNNNNDNDNNNNNNNSNEKIISIYIYEKWWRSDYTCRQNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.25
5 0.3
6 0.32
7 0.29
8 0.27
9 0.25
10 0.26
11 0.29
12 0.31
13 0.3
14 0.35
15 0.4
16 0.48
17 0.54
18 0.61
19 0.67
20 0.73
21 0.77
22 0.78
23 0.8
24 0.78
25 0.75
26 0.71
27 0.65
28 0.59
29 0.51
30 0.43
31 0.38
32 0.33
33 0.29
34 0.28
35 0.32
36 0.29
37 0.35
38 0.45
39 0.52
40 0.61
41 0.71
42 0.76
43 0.79
44 0.89
45 0.94
46 0.95
47 0.95
48 0.95
49 0.93
50 0.92
51 0.91
52 0.89
53 0.8
54 0.71
55 0.64
56 0.53
57 0.43
58 0.34
59 0.29
60 0.2
61 0.19
62 0.21
63 0.24
64 0.29
65 0.33
66 0.39
67 0.45
68 0.49
69 0.52
70 0.56
71 0.57
72 0.55
73 0.54
74 0.51
75 0.46
76 0.41
77 0.38
78 0.31
79 0.25
80 0.21
81 0.2
82 0.16
83 0.12
84 0.13
85 0.13
86 0.12
87 0.1
88 0.1
89 0.09
90 0.09
91 0.09
92 0.07
93 0.07
94 0.06
95 0.06
96 0.07
97 0.07
98 0.09
99 0.09
100 0.1
101 0.11
102 0.14
103 0.15
104 0.16
105 0.15
106 0.15
107 0.15
108 0.18
109 0.17
110 0.14
111 0.15
112 0.15
113 0.16
114 0.15
115 0.16
116 0.14
117 0.13
118 0.13
119 0.12
120 0.14
121 0.16
122 0.17
123 0.15
124 0.16
125 0.16
126 0.16
127 0.14
128 0.12
129 0.08
130 0.07
131 0.08
132 0.07
133 0.08
134 0.09
135 0.09
136 0.12
137 0.12
138 0.13
139 0.17
140 0.24
141 0.32
142 0.41
143 0.49
144 0.54
145 0.6
146 0.62
147 0.59
148 0.57
149 0.54
150 0.52
151 0.48
152 0.44
153 0.41
154 0.4
155 0.41
156 0.39
157 0.35
158 0.32
159 0.27
160 0.24
161 0.22
162 0.21
163 0.19
164 0.17
165 0.17
166 0.16
167 0.2
168 0.24
169 0.24
170 0.27
171 0.29
172 0.31
173 0.32
174 0.41
175 0.48