Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IZ55

Protein Details
Accession A0A397IZ55    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MSQKKQSRKLSHHSHYNKKRKLEKKQNSTLPADHydrophilic
NLS Segment(s)
PositionSequence
18-22KKRKL
Subcellular Location(s) nucl 19, mito_nucl 12.499, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSQKKQSRKLSHHSHYNKKRKLEKKQNSTLPADDIEPHRTQWATRGLSTSDKIYYIEKKWKSVSLSPLDCVAFNVNKISKNIYTRELLIEILIREAKIVNNEIPYLPSKFLPLINEIDHNKEIEFQTNDLKNKSWIDLGRWLGIEEPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.86
5 0.85
6 0.86
7 0.86
8 0.87
9 0.88
10 0.87
11 0.87
12 0.9
13 0.89
14 0.84
15 0.79
16 0.69
17 0.6
18 0.5
19 0.41
20 0.33
21 0.28
22 0.27
23 0.23
24 0.22
25 0.22
26 0.21
27 0.2
28 0.22
29 0.28
30 0.25
31 0.25
32 0.27
33 0.26
34 0.29
35 0.3
36 0.26
37 0.19
38 0.17
39 0.17
40 0.18
41 0.2
42 0.21
43 0.29
44 0.29
45 0.31
46 0.33
47 0.35
48 0.36
49 0.36
50 0.39
51 0.37
52 0.36
53 0.34
54 0.34
55 0.3
56 0.26
57 0.23
58 0.18
59 0.11
60 0.1
61 0.12
62 0.11
63 0.13
64 0.13
65 0.16
66 0.16
67 0.19
68 0.21
69 0.21
70 0.21
71 0.2
72 0.21
73 0.19
74 0.16
75 0.13
76 0.12
77 0.09
78 0.1
79 0.09
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.11
86 0.11
87 0.12
88 0.13
89 0.13
90 0.15
91 0.16
92 0.16
93 0.15
94 0.14
95 0.14
96 0.15
97 0.17
98 0.17
99 0.17
100 0.18
101 0.19
102 0.24
103 0.24
104 0.28
105 0.27
106 0.25
107 0.22
108 0.23
109 0.23
110 0.24
111 0.24
112 0.21
113 0.29
114 0.34
115 0.37
116 0.36
117 0.37
118 0.34
119 0.34
120 0.35
121 0.33
122 0.29
123 0.31
124 0.36
125 0.38
126 0.37
127 0.35
128 0.33