Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GZ46

Protein Details
Accession A0A397GZ46    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-149LKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKNBasic
NLS Segment(s)
PositionSequence
97-149RGPKGPKGLKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKN
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MNKKYTVSDTDLLEMIHTRWEIRHRIHRTIVKGNRKIELRRLRKNTDINNRDNDNRNNDDDNNHNNDNNNDNDNNRNNNYDDDNNNNNSNSNNHVLRGPKGPKGLKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKGPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.15
3 0.15
4 0.14
5 0.12
6 0.15
7 0.21
8 0.27
9 0.33
10 0.43
11 0.46
12 0.52
13 0.6
14 0.63
15 0.63
16 0.67
17 0.69
18 0.69
19 0.7
20 0.66
21 0.64
22 0.63
23 0.6
24 0.6
25 0.61
26 0.6
27 0.63
28 0.68
29 0.67
30 0.69
31 0.74
32 0.73
33 0.73
34 0.71
35 0.65
36 0.64
37 0.62
38 0.59
39 0.58
40 0.53
41 0.48
42 0.45
43 0.44
44 0.4
45 0.38
46 0.35
47 0.33
48 0.34
49 0.33
50 0.3
51 0.28
52 0.26
53 0.26
54 0.27
55 0.24
56 0.22
57 0.17
58 0.17
59 0.21
60 0.24
61 0.26
62 0.24
63 0.24
64 0.22
65 0.23
66 0.25
67 0.23
68 0.22
69 0.24
70 0.26
71 0.27
72 0.27
73 0.25
74 0.23
75 0.2
76 0.2
77 0.18
78 0.19
79 0.17
80 0.16
81 0.19
82 0.21
83 0.22
84 0.29
85 0.28
86 0.28
87 0.34
88 0.36
89 0.37
90 0.45
91 0.52
92 0.51
93 0.58
94 0.61
95 0.63
96 0.71
97 0.71
98 0.69
99 0.71
100 0.73
101 0.71
102 0.75
103 0.76
104 0.74
105 0.81
106 0.83
107 0.8
108 0.82
109 0.83
110 0.8
111 0.82
112 0.83
113 0.8
114 0.82
115 0.83
116 0.8
117 0.82
118 0.83
119 0.8
120 0.82
121 0.83
122 0.8
123 0.82
124 0.83
125 0.8
126 0.82
127 0.83
128 0.8
129 0.82