Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XUF9

Protein Details
Accession K1XUF9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-112NVTPGKVTKKRSPKKPKAVKLERDLEHydrophilic
NLS Segment(s)
PositionSequence
91-106GKVTKKRSPKKPKAVK
Subcellular Location(s) cyto 13.5, nucl 11, cyto_mito 8
Family & Domain DBs
KEGG mbe:MBM_05633  -  
Amino Acid Sequences MATRQPTEKEAFFFLTILNCMTNKPEVNWDLVAERAGYSNASCAKVRFGQIKKAIGYKNDGTHPITTPVKDRAAGKKVKNEIGSGTNVTPGKVTKKRSPKKPKAVKLERDLEAEEGDNGNTMKEEAGGATEYSQETAVEYADEKFEDPIHERLYHDFQATSQHQDEFLDAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.19
4 0.17
5 0.15
6 0.12
7 0.12
8 0.15
9 0.18
10 0.18
11 0.18
12 0.25
13 0.24
14 0.27
15 0.27
16 0.26
17 0.22
18 0.21
19 0.2
20 0.14
21 0.12
22 0.1
23 0.09
24 0.09
25 0.08
26 0.11
27 0.14
28 0.16
29 0.16
30 0.16
31 0.2
32 0.22
33 0.26
34 0.3
35 0.3
36 0.36
37 0.41
38 0.45
39 0.43
40 0.46
41 0.45
42 0.38
43 0.41
44 0.35
45 0.34
46 0.31
47 0.32
48 0.28
49 0.27
50 0.27
51 0.26
52 0.25
53 0.22
54 0.22
55 0.24
56 0.23
57 0.23
58 0.25
59 0.27
60 0.32
61 0.38
62 0.38
63 0.42
64 0.44
65 0.47
66 0.44
67 0.38
68 0.33
69 0.29
70 0.27
71 0.21
72 0.17
73 0.17
74 0.16
75 0.15
76 0.14
77 0.12
78 0.18
79 0.22
80 0.27
81 0.31
82 0.43
83 0.51
84 0.62
85 0.72
86 0.75
87 0.81
88 0.87
89 0.88
90 0.88
91 0.9
92 0.86
93 0.82
94 0.79
95 0.69
96 0.61
97 0.53
98 0.42
99 0.33
100 0.25
101 0.19
102 0.12
103 0.1
104 0.09
105 0.08
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.06
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.09
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.08
129 0.09
130 0.09
131 0.09
132 0.1
133 0.13
134 0.16
135 0.2
136 0.22
137 0.24
138 0.25
139 0.29
140 0.34
141 0.34
142 0.32
143 0.27
144 0.24
145 0.31
146 0.33
147 0.34
148 0.3
149 0.28
150 0.27
151 0.27
152 0.28