Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G760

Protein Details
Accession A0A397G760    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-34EKKGENRREERGKTNKRKEVKBasic
78-102DLARRRIKSARRKRGYKIRGRDEGSBasic
NLS Segment(s)
PositionSequence
15-37KKGENRREERGKTNKRKEVKGVK
80-98ARRRIKSARRKRGYKIRGR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MESKLIGEIGEIDEKKGENRREERGKTNKRKEVKGVKICHKEAIESRRRGMGSKLTEEEGRIGEIEGEIDEKKGEIDDLARRRIKSARRKRGYKIRGRDEGSENMSEKRQWNREEEEWGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.29
4 0.32
5 0.35
6 0.4
7 0.49
8 0.57
9 0.62
10 0.67
11 0.7
12 0.76
13 0.78
14 0.83
15 0.82
16 0.79
17 0.8
18 0.8
19 0.79
20 0.79
21 0.77
22 0.75
23 0.76
24 0.77
25 0.73
26 0.68
27 0.57
28 0.49
29 0.47
30 0.48
31 0.47
32 0.42
33 0.42
34 0.41
35 0.41
36 0.39
37 0.35
38 0.33
39 0.27
40 0.28
41 0.28
42 0.25
43 0.25
44 0.25
45 0.23
46 0.16
47 0.12
48 0.09
49 0.07
50 0.06
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.07
64 0.14
65 0.18
66 0.26
67 0.29
68 0.29
69 0.32
70 0.38
71 0.44
72 0.48
73 0.56
74 0.6
75 0.67
76 0.73
77 0.8
78 0.85
79 0.86
80 0.85
81 0.84
82 0.82
83 0.81
84 0.79
85 0.75
86 0.68
87 0.64
88 0.58
89 0.51
90 0.44
91 0.37
92 0.36
93 0.34
94 0.34
95 0.37
96 0.4
97 0.4
98 0.45
99 0.5
100 0.52
101 0.58