Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GLT1

Protein Details
Accession A0A397GLT1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-73KEYIKGRKEKSELKKKERKFKKELKEYKKKLFKEIKDERLKRKENKREKAREKHVMWBasic
NLS Segment(s)
PositionSequence
20-69IKGRKEKSELKKKERKFKKELKEYKKKLFKEIKDERLKRKENKREKAREK
Subcellular Location(s) nucl 18.5, mito_nucl 14.333, cyto_nucl 10.166, mito 8
Family & Domain DBs
Amino Acid Sequences MLSNVKQNARLISNKVKEYIKGRKEKSELKKKERKFKKELKEYKKKLFKEIKDERLKRKENKREKAREKHVMWGKNEVFIIWGRKFKFFLNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.45
4 0.45
5 0.49
6 0.52
7 0.51
8 0.55
9 0.56
10 0.6
11 0.64
12 0.69
13 0.72
14 0.73
15 0.74
16 0.75
17 0.81
18 0.8
19 0.85
20 0.85
21 0.83
22 0.82
23 0.82
24 0.82
25 0.84
26 0.87
27 0.86
28 0.87
29 0.85
30 0.85
31 0.83
32 0.74
33 0.72
34 0.71
35 0.64
36 0.64
37 0.66
38 0.66
39 0.68
40 0.72
41 0.72
42 0.73
43 0.77
44 0.75
45 0.77
46 0.78
47 0.78
48 0.84
49 0.85
50 0.87
51 0.89
52 0.91
53 0.9
54 0.89
55 0.8
56 0.79
57 0.76
58 0.72
59 0.64
60 0.63
61 0.54
62 0.48
63 0.46
64 0.36
65 0.29
66 0.26
67 0.3
68 0.25
69 0.3
70 0.29
71 0.32
72 0.34