Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HMZ3

Protein Details
Accession A0A397HMZ3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-82FWNPPEKYVWKKLPKARKLKKLHydrophilic
NLS Segment(s)
PositionSequence
71-82KKLPKARKLKKL
Subcellular Location(s) mito 20, mito_nucl 14, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013783  Ig-like_fold  
Amino Acid Sequences MKRGILAKVRIPAKNGNPVIPHNSEVKITMITSSGECIDRPVLIKRETQDLSMRKAYDAIFWNPPEKYVWKKLPKARKLKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.45
4 0.42
5 0.43
6 0.45
7 0.4
8 0.36
9 0.29
10 0.28
11 0.25
12 0.23
13 0.21
14 0.16
15 0.13
16 0.12
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.08
27 0.1
28 0.12
29 0.15
30 0.16
31 0.18
32 0.18
33 0.25
34 0.25
35 0.25
36 0.29
37 0.28
38 0.31
39 0.33
40 0.32
41 0.26
42 0.27
43 0.26
44 0.24
45 0.25
46 0.24
47 0.25
48 0.26
49 0.3
50 0.28
51 0.28
52 0.27
53 0.27
54 0.31
55 0.35
56 0.44
57 0.5
58 0.59
59 0.67
60 0.75
61 0.8
62 0.84